StarFunc result for job id P78332

User Input

>input (1123 residues)
MWGDSRPANRTGPFRGSQEERFAPGWNRDYPPPPLKSHAQERHSGNFPGRDSLPFDFQGH
SGPPFANVEEHSFSYGARDGPHGDYRGGEGPGHDFRGGDFSSSDFQSRDSSQLDFRGRDI
HSGDFRDREGPPMDYRGGDGTSMDYRGREAPHMNYRDRDAHAVDFRGRDAPPSDFRGRGT
YDLDFRGRDGSHADFRGRDLSDLDFRAREQSRSDFRNRDVSDLDFRDKDGTQVDFRGRGS
GTTDLDFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPST
QDREHSGMNVNRREESTHDHTIERPAFGIQKGEFEHSETREGETQGVAFEHESPADFQNS
QSPVQDQDKSQLSGREEQSSDAGLFKEEGGLDFLGRQDTDYRSMEYRDVDHRLPGSQMFG
YGQSKSFPEGKTARDAQRDLQDQDYRTGPSEEKPSRLIRLSGVPEDATKEEILNAFRTPD
GMPVKNLQLKEYNTGYDYGYVCVEFSLLEDAIGCMEANQGTLMIQDKEVTLEYVSSLDFW
YCKRCKANIGGHRSSCSFCKNPREVTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADK
EPEPRKREEGQESRLGHQKREAERYLPPSRREGPTFRRDRERESWSGETRQDGESKTIML
KRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKILQ
NLDPPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNR
QGQQSSSDCYIYDSATGYYYDPLAGTYYDPNTQQEVYVPQDPGLPEEEEIKEKKPTSQGK
SSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNP
LIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLC
RRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGKFKGRGNDRREKL
QSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASS
EEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78332	0.999	0.999	0.000	1123	1.000	1.000	P78332.pdb.gz	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
2	AFDB:S4R1W5	0.294	0.296	0.000	1118	0.890	0.894	S4R1W5.pdb.gz	S4R1W5_MOUSE RNA binding motif protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
3	AFDB:Q9VJ12	0.067	0.096	2.567E-5	739	0.079	0.120	Q9VJ12.pdb.gz	Q9VJ12_DROME Acinus, isoform A OS=Drosophila melanogaster OX=7227 GN=Acn PE=1 SV=1
4	AFDB:D3ZHK8	0.075	0.111	4.426E-5	717	0.093	0.145	D3ZHK8.pdb.gz	D3ZHK8_RAT Cytoplasmic polyadenylation element binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cpeb2 PE=1 SV=4
5	AFDB:D3Z8E6	0.058	0.044	7.182E-5	1604	0.159	0.112	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
6	AFDB:Q8IRB5	0.038	0.032	1.097E-4	1465	0.132	0.101	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
7	AFDB:Q86A78	0.051	0.045	1.780E-4	1282	0.109	0.095	Q86A78.pdb.gz	Q86A78_DICDI Calcium-binding EF-hand domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1124 PE=4 SV=1
8	PDB:5lsbA	0.066	0.377	2.568E-4	176	0.023	0.148	5lsbA.pdb.gz
9	PDB:5vsuA	0.069	0.174	3.923E-4	387	0.027	0.078	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
10	PDB:5xjcw	0.064	0.629	4.997E-4	91	0.020	0.242	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
11	AFDB:O65655	0.071	0.120	7.608E-4	633	0.072	0.128	O65655.pdb.gz	O65655_ARATH SAP domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g39680 PE=1 SV=1
12	PDB:3lqvB	0.063	0.521	8.616E-4	115	0.013	0.130	3lqvB.pdb.gz	Branch Recognition by SF3b14
13	PDB:7oqcF	0.067	0.260	8.616E-4	267	0.027	0.112	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
14	AFDB:Q7Z3T8	0.048	0.040	1.312E-3	1539	0.126	0.092	Q7Z3T8.pdb.gz	ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3
15	PDB:6ff7X	0.063	0.348	1.677E-3	171	0.013	0.088	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
16	AFDB:Q8SXD4	0.056	0.057	2.004E-3	1122	0.114	0.114	Q8SXD4.pdb.gz	MIDN_DROME Midnolin homolog OS=Drosophila melanogaster OX=7227 GN=stx PE=1 SV=1
17	PDB:6gd1A	0.063	0.334	2.010E-3	190	0.012	0.068	6gd1A.pdb.gz
18	PDB:6qx91K	0.072	0.358	2.010E-3	201	0.015	0.085	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:6n7pY	0.066	0.452	3.912E-3	138	0.020	0.167	6n7pY.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
20	PDB:6qw6R	0.068	0.564	4.156E-3	106	0.010	0.104	6qw6R.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88720	0.0	1957	1117	0.881	0.885	O88720_MOUSE RNA binding protein OS=Mus musculus OX=10090 GN=Rbm6 PE=2 SV=2
2	P78332	0.0	2305	1123	1.000	1.000	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
3	Q3TPF1	0.0	835	463	0.381	0.924	Q3TPF1_MOUSE RNA-binding protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=2 SV=1
4	Q3ULB0	0.0	1730	986	0.777	0.885	Q3ULB0_MOUSE RNA binding motif protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
5	Q5DTS4	0.0	1942	1109	0.874	0.885	Q5DTS4_MOUSE MKIAA4015 protein (Fragment) OS=Mus musculus OX=10090 GN=Rbm6 PE=2 SV=1
6	S4R1W5	0.0	1995	1118	0.890	0.894	S4R1W5_MOUSE RNA binding motif protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
7	Q9CRY1	3.37e-149	447	244	0.202	0.930	Q9CRY1_MOUSE OCRE domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Rbm6 PE=2 SV=2
8	A0A0A6YY54	1.37e-115	357	187	0.154	0.925	A0A0A6YY54_MOUSE RNA binding motif protein 6 (Fragment) OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
9	P52756	1.17e-54	207	815	0.126	0.174	RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2
10	P70501	2.83e-42	169	852	0.112	0.148	RBM10_RAT RNA-binding protein 10 OS=Rattus norvegicus OX=10116 GN=Rbm10 PE=1 SV=1
11	A0A0S2Z4X1	1.03e-40	164	852	0.110	0.146	A0A0S2Z4X1_HUMAN Epididymis secretory sperm binding protein (Fragment) OS=Homo sapiens OX=9606 GN=RBM10 PE=2 SV=1
12	A0A0S2Z4W4	1.88e-40	164	930	0.110	0.133	A0A0S2Z4W4_HUMAN RNA binding motif protein 10 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=RBM10 PE=2 SV=1
13	P98175	1.88e-40	164	930	0.110	0.133	RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10 PE=1 SV=3
14	A0A0A6YXE2	7.23e-38	138	77	0.057	0.831	A0A0A6YXE2_MOUSE RNA binding motif protein 6 (Fragment) OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=5
15	A0A0A6YWN4	1.34e-33	125	59	0.052	0.983	A0A0A6YWN4_MOUSE RNA binding motif protein 6 (Fragment) OS=Mus musculus OX=10090 GN=Rbm6 PE=4 SV=1
16	Q99KG3	2.86e-25	115	930	0.081	0.098	RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus OX=10090 GN=Rbm10 PE=1 SV=1
17	S4R1I5	2.33e-21	90.1	42	0.037	0.976	S4R1I5_MOUSE RNA binding motif protein 6 (Fragment) OS=Mus musculus OX=10090 GN=Rbm6 PE=4 SV=1
18	Q8SZM4	2.55e-14	80.5	1004	0.062	0.070	Q8SZM4_DROME RH03791p OS=Drosophila melanogaster OX=7227 GN=CG4887 PE=2 SV=1
19	Q9VPY4	3.58e-14	80.1	1004	0.061	0.069	Q9VPY4_DROME FI21118p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4887 PE=1 SV=1
20	P87143	1.85e-06	54.3	565	0.040	0.080	YDMD_SCHPO Uncharacterized RNA-binding protein C57A7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC57A7.13 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01585 G-patch	0.00022	32.4	G-patch domain
2	PF11714 Inhibitor_I53	4.7e+02	12.4	Thrombin inhibitor Madanin
3	PF17780 OCRE	1.7e-11	55.4	OCRE domain
4	PF13599 Pentapeptide_4	11	17.6	Pentapeptide repeats (9 copies)
5	PF00076 RRM_1	0.99	20.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
6	PF12171 zf-C2H2_jaz	5.1e+02	12.4	Zinc-finger double-stranded RNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266022

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407107	0.800	HERV-H LTR-associating 1
2	9606.ENSP00000300249	0.687	Microtubule-associated protein RP/EB family member 2
3	9606.ENSP00000326261	0.679	Serine/arginine repetitive matrix protein 1
4	9606.ENSP00000257940	0.662	Zinc finger CCCH domain-containing protein 10
5	9606.ENSP00000229214	0.657	KRR1 small subunit processome component homolog
6	9606.ENSP00000253363	0.655	RNA-binding protein 39
7	9606.ENSP00000359935	0.649	Fucose-1-phosphate guanylyltransferase
8	9606.ENSP00000402653	0.626	WD repeat domain-containing protein 83
9	9606.ENSP00000287202	0.625	CUGBP Elav-like family member 6
10	9606.ENSP00000267113	0.616	Extended synaptotagmin-1
11	9606.ENSP00000314348	0.608	Probable ATP-dependent RNA helicase DDX10
12	9606.ENSP00000423463	0.602	LY75-CD302 readthrough
13	9606.ENSP00000262283	0.590	Otoconin-90
14	9606.ENSP00000275732	0.569	GRB10-interacting GYF protein 1
15	9606.ENSP00000161006	0.541	Brain-specific serine protease 4
16	9606.ENSP00000389787	0.530	Pleckstrin homology domain-containing family F member 1
17	9606.ENSP00000297990	0.527	Nucleolar protein 6
18	9606.ENSP00000292782	0.525	DCN1-like protein 1
19	9606.ENSP00000350651	0.524	ERI1 exoribonuclease family member 2
20	9606.ENSP00000254627	0.519	Otoconin 90

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003677	1.000	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006396	0.985	RNA processing
GO:0065007	0.703	biological regulation
GO:0050789	0.660	regulation of biological process
GO:0050794	0.542	regulation of cellular process
GO:0019222	0.426	regulation of metabolic process
GO:0060255	0.410	regulation of macromolecule metabolic process
GO:0080090	0.408	regulation of primary metabolic process
GO:0051171	0.408	regulation of nitrogen compound metabolic process
GO:0031323	0.377	regulation of cellular metabolic process
GO:0010468	0.317	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.470	intracellular organelle lumen
GO:0031981	0.415	nuclear lumen
GO:0005654	0.392	nucleoplasm
GO:0005737	0.364	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]