StarFunc result for job id P78337

User Input

>input (314 residues)
MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKER
GGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMRE
EIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYS
YNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNS
GLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGL
QGPASGLNACQYNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70314	0.669	0.667	1.803E-41	315	0.968	0.965	P70314.pdb.gz	PITX1_MOUSE Pituitary homeobox 1 OS=Mus musculus OX=10090 GN=Pitx1 PE=2 SV=2
2	AFDB:P56673	0.426	0.430	2.026E-34	311	0.825	0.833	P56673.pdb.gz	PITX1_CHICK Pituitary homeobox 1 OS=Gallus gallus OX=9031 GN=PITX1 PE=2 SV=1
3	AFDB:Q9W5Z2	0.477	0.477	2.018E-26	314	0.602	0.602	Q9W5Z2.pdb.gz	PITX2_DANRE Pituitary homeobox 2 OS=Danio rerio OX=7955 GN=pitx2 PE=2 SV=1
4	AFDB:O93385	0.398	0.377	2.781E-26	333	0.646	0.610	O93385.pdb.gz	PITX2_CHICK Pituitary homeobox 2 OS=Gallus gallus OX=9031 GN=PITX2 PE=2 SV=1
5	AFDB:Q9PWR3	0.364	0.351	8.280E-26	326	0.592	0.571	Q9PWR3.pdb.gz	PITX2_XENLA Pituitary homeobox 2 OS=Xenopus laevis OX=8355 GN=pitx2 PE=2 SV=1
6	AFDB:O35160	0.377	0.390	2.559E-20	302	0.510	0.530	O35160.pdb.gz	PITX3_MOUSE Pituitary homeobox 3 OS=Mus musculus OX=10090 GN=Pitx3 PE=1 SV=1
7	AFDB:Q6DGH9	0.231	0.230	9.335E-10	315	0.239	0.238	Q6DGH9.pdb.gz	OTBP_DANRE Homeobox protein orthopedia B OS=Danio rerio OX=7955 GN=otpb PE=1 SV=1
8	AFDB:O09113	0.228	0.221	1.560E-9	325	0.274	0.265	O09113.pdb.gz	OTP_MOUSE Homeobox protein orthopedia OS=Mus musculus OX=10090 GN=Otp PE=2 SV=1
9	AFDB:B3DGA5	0.250	0.239	1.891E-9	332	0.220	0.208	B3DGA5.pdb.gz	B3DGA5_DANRE Homeobox protein orthopedia OS=Danio rerio OX=7955 GN=otpa PE=2 SV=1
10	AFDB:P52906	0.230	0.224	3.160E-9	323	0.258	0.251	P52906.pdb.gz	UNC30_CAEEL Homeobox protein unc-30 OS=Caenorhabditis elegans OX=6239 GN=unc-30 PE=2 SV=2
11	PDB:4egcA	0.159	0.093	1.333E-2	539	0.057	0.033	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.158	0.614	1.516E-2	73	0.067	0.288	2hi3A.pdb.gz
13	PDB:7dcoL	0.124	0.091	5.511E-1	435	0.054	0.039	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
14	PDB:7fbyA	0.115	0.220	8.099E-1	153	0.051	0.105	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:5z56L	0.108	0.100	1.353	342	0.045	0.041	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
16	PDB:2cg4A	0.129	0.257	1.539	149	0.013	0.027	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:4ldzA	0.156	0.240	2.411	196	0.032	0.051	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
18	PDB:7pnw2	0.091	0.204	2.411	117	0.041	0.111	7pnw2.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
19	PDB:5mymC	0.136	0.184	2.741	205	0.045	0.068	5mymC.pdb.gz	Target Identification of Mycobacterium tuberculosis Phenotypic Hits Using a Concerted Chemogenomic, Biophysical, and Structural Approach.
20	PDB:7p2e2	0.089	0.204	2.741	117	0.045	0.120	7p2e2.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56673	0.0	526	311	0.825	0.833	PITX1_CHICK Pituitary homeobox 1 OS=Gallus gallus OX=9031 GN=PITX1 PE=2 SV=1
2	P70314	0.0	587	315	0.965	0.962	PITX1_MOUSE Pituitary homeobox 1 OS=Mus musculus OX=10090 GN=Pitx1 PE=2 SV=2
3	P78337	0.0	645	314	1.000	1.000	PITX1_HUMAN Pituitary homeobox 1 OS=Homo sapiens OX=9606 GN=PITX1 PE=1 SV=2
4	Q99NA7	0.0	584	315	0.959	0.956	PITX1_RAT Pituitary homeobox 1 OS=Rattus norvegicus OX=10116 GN=Pitx1 PE=2 SV=1
5	Q6QU75	2.96e-111	326	293	0.589	0.631	PITX3_DANRE Pituitary homeobox 3 OS=Danio rerio OX=7955 GN=pitx3 PE=2 SV=1
6	Q9R0W1	7.10e-109	321	324	0.605	0.586	PITX2_RAT Pituitary homeobox 2 OS=Rattus norvegicus OX=10116 GN=Pitx2 PE=2 SV=1
7	O93385	8.56e-108	318	333	0.653	0.616	PITX2_CHICK Pituitary homeobox 2 OS=Gallus gallus OX=9031 GN=PITX2 PE=2 SV=1
8	Q9W5Z2	6.38e-107	316	314	0.605	0.605	PITX2_DANRE Pituitary homeobox 2 OS=Danio rerio OX=7955 GN=pitx2 PE=2 SV=1
9	Q99697	7.05e-107	316	317	0.599	0.593	PITX2_HUMAN Pituitary homeobox 2 OS=Homo sapiens OX=9606 GN=PITX2 PE=1 SV=2
10	P97474	1.10e-106	315	317	0.608	0.603	PITX2_MOUSE Pituitary homeobox 2 OS=Mus musculus OX=10090 GN=Pitx2 PE=1 SV=2
11	Q9PWR3	1.13e-105	313	326	0.589	0.567	PITX2_XENLA Pituitary homeobox 2 OS=Xenopus laevis OX=8355 GN=pitx2 PE=2 SV=1
12	D6RFI4	4.72e-94	282	290	0.551	0.597	D6RFI4_HUMAN Paired like homeodomain 2 (Fragment) OS=Homo sapiens OX=9606 GN=PITX2 PE=1 SV=1
13	O75364	6.41e-88	267	302	0.503	0.523	PITX3_HUMAN Pituitary homeobox 3 OS=Homo sapiens OX=9606 GN=PITX3 PE=1 SV=1
14	O35160	1.77e-85	261	302	0.519	0.540	PITX3_MOUSE Pituitary homeobox 3 OS=Mus musculus OX=10090 GN=Pitx3 PE=1 SV=1
15	P81062	3.78e-85	260	302	0.516	0.536	PITX3_RAT Pituitary homeobox 3 OS=Rattus norvegicus OX=10116 GN=Pitx3 PE=1 SV=2
16	O18400	1.23e-53	184	509	0.382	0.236	PITX_DROME Pituitary homeobox homolog Ptx1 OS=Drosophila melanogaster OX=7227 GN=Ptx1 PE=2 SV=2
17	P52906	2.75e-34	129	323	0.213	0.207	UNC30_CAEEL Homeobox protein unc-30 OS=Caenorhabditis elegans OX=6239 GN=unc-30 PE=2 SV=2
18	Q1LVQ7	7.35e-28	112	320	0.293	0.287	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
19	Q9H161	1.11e-25	107	411	0.280	0.214	ALX4_HUMAN Homeobox protein aristaless-like 4 OS=Homo sapiens OX=9606 GN=ALX4 PE=1 SV=2
20	Q63087	1.17e-25	106	326	0.245	0.236	ALX1_RAT ALX homeobox protein 1 OS=Rattus norvegicus OX=10116 GN=Alx1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	40	15.5	Homeobox KN domain
2	PF00046 Homeodomain	8.7e-19	78.4	Homeodomain
3	PF03826 OAR	0.00069	30.6	OAR motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265340

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000239938	0.882	Early growth response protein 1
2	9606.ENSP00000240335	0.876	T-box transcription factor TBX4
3	9606.ENSP00000362690	0.875	Steroidogenic factor 1
4	9606.ENSP00000342931	0.804	Pituitary-specific positive transcription factor 1
5	9606.ENSP00000356795	0.765	T-box transcription factor TBX19
6	9606.ENSP00000309913	0.745	T-box transcription factor TBX5
7	9606.ENSP00000340176	0.696	RNA-binding protein with multiple splicing
8	9606.ENSP00000258829	0.677	Homeobox protein Nkx-2.8
9	9606.ENSP00000360811	0.651	LIM/homeobox protein Lhx3
10	9606.ENSP00000421544	0.598	Pterin-4-alpha-carbinolamine dehydratase 2
11	9606.ENSP00000368880	0.590	Forkhead box protein O1
12	9606.ENSP00000332973	0.588	Mothers against decapentaplegic homolog 3
13	9606.ENSP00000263726	0.579	LIM/homeobox protein Lhx4
14	9606.ENSP00000295108	0.565	Neurogenic differentiation factor 1
15	9606.ENSP00000274813	0.564	Methylmalonyl-CoA mutase, mitochondrial
16	9606.ENSP00000325819	0.562	COUP transcription factor 1
17	9606.ENSP00000381499	0.560	Paired box protein Pax-1
18	9606.ENSP00000287020	0.559	Growth/differentiation factor 6
19	9606.ENSP00000372193	0.559	H(+)/Cl(-) exchange transporter 7
20	9606.ENSP00000264731	0.552	Tumor protein 63

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0001228	0.997	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.997	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0048856	0.995	anatomical structure development
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0009889	0.989	regulation of biosynthetic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0032501	0.987	multicellular organismal process
GO:0080090	0.987	regulation of primary metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0007275	0.952	multicellular organism development
GO:0048731	0.925	system development
GO:0048513	0.894	animal organ development
GO:0048518	0.883	positive regulation of biological process
GO:0009987	0.859	cellular process
GO:0048522	0.853	positive regulation of cellular process
GO:0009653	0.844	anatomical structure morphogenesis
GO:0009893	0.801	positive regulation of metabolic process
GO:0010604	0.762	positive regulation of macromolecule metabolic process
GO:0031325	0.756	positive regulation of cellular metabolic process
GO:0051173	0.755	positive regulation of nitrogen compound metabolic process
GO:0006357	0.725	regulation of transcription by RNA polymerase II
GO:0045935	0.712	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.711	positive regulation of cellular biosynthetic process
GO:0045893	0.698	positive regulation of DNA-templated transcription
GO:0045944	0.502	positive regulation of transcription by RNA polymerase II
GO:0048519	0.364	negative regulation of biological process
GO:0048523	0.324	negative regulation of cellular process
GO:0050896	0.315	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.906	nuclear lumen
GO:0005654	0.895	nucleoplasm
GO:0005737	0.590	cytoplasm
GO:0032991	0.424	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]