StarFunc result for job id P78344

User Input

>input (907 residues)
MESAIAEGGASRFSASSGGGGSRGAPQHYPKTAGNSEFLGKTPGQNAQKWIPARSTRRDD
NSAANNSANEKERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVD
KALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTR
NVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKK
RVQLKDMGEDLECLCQIMRTVGPRLDHERAKSLMDQYFARMCSLMLSKELPARIRFLLQD
TVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPR
MKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQS
QFGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPAQSF
LMNKNQVPKLQPQITMIPPSAQPPRTQTPPLGQTPQLGLKTNPPLIQEKPAKTSKKPPPS
KEELLKLTETVVTEYLNSGNANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKA
SSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISE
LAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILE
GKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYI
SSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYN
SNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEE
ESEEEAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3DQV9	0.742	0.742	1.127E-91	907	0.998	0.998	D3DQV9.pdb.gz	D3DQV9_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
2	AFDB:H0Y3P2	0.429	0.447	5.317E-88	869	0.957	0.999	H0Y3P2.pdb.gz	H0Y3P2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
3	AFDB:F1R9I0	0.416	0.424	3.813E-80	891	0.819	0.834	F1R9I0.pdb.gz
4	AFDB:O43432	0.237	0.140	2.646E-26	1585	0.272	0.156	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
5	AFDB:Q93ZT6	0.261	0.301	6.335E-21	780	0.203	0.236	Q93ZT6.pdb.gz	IF4G1_ARATH Eukaryotic translation initiation factor isoform 4G-1 OS=Arabidopsis thaliana OX=3702 GN=EIF(ISO)4G1 PE=1 SV=1
6	AFDB:Q1MSJ0	0.257	0.291	2.980E-20	793	0.195	0.223	Q1MSJ0.pdb.gz	Q1MSJ0_ORYGL Putative eukaryotic translation initiation factor 4 gamma OS=Oryza glaberrima OX=4538 GN=eif(iso)4g PE=2 SV=1
7	AFDB:B5BM24	0.239	0.190	1.910E-11	1159	0.157	0.123	B5BM24.pdb.gz	B5BM24_CAEEL MIF4G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ifg-1 PE=1 SV=2
8	PDB:7dvqV	0.196	0.364	1.908E-6	468	0.084	0.162	7dvqV.pdb.gz	Structure of the activated human minor spliceosome.
9	PDB:3feyA	0.185	0.217	1.644E-4	761	0.097	0.116	3feyA.pdb.gz
10	PDB:4jhjA	0.184	0.690	2.224E-4	216	0.054	0.227	4jhjA.pdb.gz	Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins.
11	PDB:5gm6Z	0.201	0.394	4.225E-4	447	0.084	0.170	5gm6Z.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
12	PDB:5mqfT	0.194	0.421	5.103E-4	395	0.046	0.106	5mqfT.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
13	PDB:1h2uA	0.183	0.231	6.164E-4	706	0.090	0.116	1h2uA.pdb.gz	Large-Scale Induced Fit Recognition of an M(7)Gpppg CAP Analogue by the Human Nuclear CAP-Binding Complex
14	PDB:5oobF	0.185	0.230	8.992E-4	718	0.098	0.124	5oobF.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
15	PDB:6bk8L	0.195	0.415	1.263E-3	412	0.082	0.180	6bk8L.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
16	PDB:7f66J	0.153	0.230	5.305E-3	591	0.036	0.056	7f66J.pdb.gz
17	AFDB:O42874	0.097	0.069	5.973E-3	1462	0.135	0.083	O42874.pdb.gz	STU1_SCHPO Protein peg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=peg1 PE=1 SV=1
18	PDB:6n7pX	0.192	0.209	3.013E-2	826	0.077	0.085	6n7pX.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
19	AFDB:P38903	0.124	0.141	5.141E-2	757	0.099	0.119	P38903.pdb.gz	2A5D_YEAST Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTS1 PE=1 SV=2
20	AFDB:E3W994	0.146	0.114	6.448E-2	1273	0.137	0.097	E3W994.pdb.gz	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A1T4	0.0	1840	906	0.990	0.991	A0A8I6A1T4_RAT Eukaryotic translation initiation factor 4, gamma 2 OS=Rattus norvegicus OX=10116 GN=Eif4g2 PE=1 SV=1
2	A0A8I6A9V3	0.0	1744	868	0.948	0.991	A0A8I6A9V3_RAT Eukaryotic translation initiation factor 4, gamma 2 OS=Rattus norvegicus OX=10116 GN=Eif4g2 PE=1 SV=1
3	A0A8I6ADP1	0.0	1619	828	0.882	0.966	A0A8I6ADP1_RAT Eukaryotic translation initiation factor 4, gamma 2 OS=Rattus norvegicus OX=10116 GN=Eif4g2 PE=1 SV=1
4	D3DQV9	0.0	1858	907	0.999	0.999	D3DQV9_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
5	H0Y3P2	0.0	1763	869	0.957	0.999	H0Y3P2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
6	H0YCH5	0.0	904	444	0.490	1.000	H0YCH5_HUMAN Eukaryotic translation initiation factor 4 gamma 2 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=2
7	P78344	0.0	1860	907	1.000	1.000	IF4G2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
8	P79398	0.0	1855	907	0.997	0.997	IF4G2_RABIT Eukaryotic translation initiation factor 4 gamma 2 OS=Oryctolagus cuniculus OX=9986 GN=EIF4G2 PE=2 SV=1
9	Q1RP76	0.0	725	412	0.412	0.908	Q1RP76_RAT ZH8 protein OS=Rattus norvegicus OX=10116 GN=Eif4g2 PE=2 SV=1
10	Q5BJU2	0.0	853	426	0.463	0.986	Q5BJU2_RAT Eif4g2 protein OS=Rattus norvegicus OX=10116 GN=Eif4g2 PE=1 SV=1
11	Q5KTT7	0.0	1457	891	0.809	0.824	Q5KTT7_DANRE Eukaryotic translation initiation factor 4, gamma 2a OS=Danio rerio OX=7955 GN=NAT1A PE=1 SV=1
12	Q62448	0.0	1843	906	0.991	0.992	IF4G2_MOUSE Eukaryotic translation initiation factor 4 gamma 2 OS=Mus musculus OX=10090 GN=Eif4g2 PE=1 SV=2
13	A1Z968	2.04e-76	275	1488	0.182	0.111	A1Z968_DROME NAT1, isoform D OS=Drosophila melanogaster OX=7227 GN=NAT1 PE=1 SV=1
14	Q0E996	3.32e-73	261	918	0.160	0.158	Q0E996_DROME FI23508p1 OS=Drosophila melanogaster OX=7227 GN=NAT1 PE=1 SV=1
15	Q04637	7.81e-52	200	1599	0.127	0.072	IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4
16	B4DGF1	7.88e-52	200	1566	0.127	0.073	B4DGF1_HUMAN cDNA FLJ56479, highly similar to Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 PE=2 SV=1
17	B2RU06	8.12e-52	200	1606	0.127	0.072	B2RU06_HUMAN eIF4G1 protein OS=Homo sapiens OX=9606 GN=EIF4G1 PE=2 SV=1
18	B2RU10	8.19e-52	200	1606	0.127	0.072	B2RU10_HUMAN eIF4G1 protein OS=Homo sapiens OX=9606 GN=EIF4G1 PE=2 SV=1
19	E7EUU4	8.35e-52	200	1560	0.127	0.074	E7EUU4_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
20	Q4LE58	8.88e-52	200	1624	0.127	0.071	Q4LE58_HUMAN eIF4G1 variant protein (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 variant protein PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02847 MA3	1.6e-13	62.0	MA3 domain
2	PF02854 MIF4G	2.4e-54	195.7	MIF4G domain
3	PF02020 W2	9.5e-17	72.2	eIF4-gamma/eIF5/eIF2-epsilon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006046054.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006041668.1	0.999	Eukaryotic translation initiation factor 4E-like
2	89462.XP_006062918.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 29 samples with support for all annotated introns
3	89462.XP_006058672.1	0.994	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
4	89462.XP_006075632.1	0.993	Eukaryotic translation initiation factor 4E type 1B
5	89462.XP_006042328.1	0.991	Eukaryotic translation initiation factor 4 gamma 3
6	89462.XP_006056804.1	0.985	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns
7	89462.XP_006048513.1	0.981	Eukaryotic translation initiation factor 3 subunit A
8	89462.XP_006054741.1	0.981	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
9	89462.XP_006069518.1	0.973	Eukaryotic initiation factor 4A-II-like
10	89462.XP_006075804.1	0.963	Eukaryotic translation initiation factor 2 subunit 2
11	89462.XP_006076871.1	0.958	Eukaryotic translation initiation factor 4 gamma 1-like
12	89462.XP_006043558.1	0.954	Eukaryotic translation initiation factor 4 gamma 3-like isoform X1
13	89462.XP_006046081.1	0.951	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 86% coverage of the annotated genomic feature by RNAseq alignments
14	89462.XP_006070582.1	0.939	Eukaryotic translation initiation factor 3 subunit C-like
15	89462.XP_006041878.1	0.899	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
16	89462.XP_006063524.1	0.894	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
17	89462.XP_006079100.1	0.879	Eukaryotic translation initiation factor 5
18	89462.XP_006042102.1	0.876	DNA-directed RNA polymerase I subunit RPA1-like
19	89462.XP_006046669.1	0.869	Eukaryotic translation initiation factor 4B isoform X1
20	89462.XP_006054289.1	0.855	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003743	1.000	translation initiation factor activity
GO:0003723	0.989	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010608	0.996	post-transcriptional regulation of gene expression
GO:0034248	0.995	regulation of amide metabolic process
GO:0051246	0.995	regulation of protein metabolic process
GO:2000112	0.995	regulation of cellular macromolecule biosynthetic process
GO:0006417	0.992	regulation of translation
GO:0009987	0.926	cellular process
GO:0048518	0.903	positive regulation of biological process
GO:0006446	0.890	regulation of translational initiation
GO:0032502	0.855	developmental process
GO:0048522	0.679	positive regulation of cellular process
GO:0009893	0.655	positive regulation of metabolic process
GO:0010604	0.609	positive regulation of macromolecule metabolic process
GO:0071704	0.490	organic substance metabolic process
GO:0051173	0.477	positive regulation of nitrogen compound metabolic process
GO:0043170	0.438	macromolecule metabolic process
GO:0048856	0.435	anatomical structure development
GO:0071840	0.386	cellular component organization or biogenesis
GO:0034250	0.378	positive regulation of amide metabolic process
GO:0044237	0.362	cellular metabolic process
GO:0031325	0.357	positive regulation of cellular metabolic process
GO:0006807	0.327	nitrogen compound metabolic process
GO:0010628	0.319	positive regulation of gene expression
GO:0045727	0.302	positive regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.947	protein-containing complex
GO:0043226	0.941	organelle
GO:0043231	0.837	intracellular membrane-bounded organelle
GO:0070013	0.805	intracellular organelle lumen
GO:0005634	0.796	nucleus
GO:0042995	0.654	cell projection
GO:0031981	0.645	nuclear lumen
GO:0120025	0.639	plasma membrane bounded cell projection
GO:0043005	0.605	neuron projection
GO:0005654	0.563	nucleoplasm
GO:0016020	0.560	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]