StarFunc result for job id P78347

User Input

>input (998 residues)
MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVYETDVFVVGTE
RGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYF
CFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGI
SFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVK
EESEDPDYYQYNIQAGPSETDDVDEKQPLSKPLQGSHHSSEGNEGTEMEVPAEDSTQHVP
SETSEDPEVEVTIEDDDYSPPSKRPKANELPQPPVPEPANAGKRKVREFNFEKWNARITD
LRKQVEELFERKYAQAIKAKGPVTIPYPLFQSHVEDLYVEGLPEGIPFRRPSTYGIPRLE
RILLAKERIRFVIKKHELLNSTREDLQLDKPASGVKEEWYARITKLRKMVDQLFCKKFAE
ALGSTEAKAVPYQKFEAHPNDLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKR
PELLTHSTTEVTQPRTNTPVKEDWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVF
ESNPEFLYVEGLPEGIPFRSPTWFGIPRLERIVRGSNKIKFVVKKPELVISYLPPGMASK
INTKALQSPKRPRSPGSNSKVPEIEVTVEGPNNNNPQTSAVRTPTQTNGSNVPFKPRGRE
FSFEAWNAKITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPF
RRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKESTSSKSPPRKINSSPNVNTTASG
VEDLNIIQVTIPDDDNERLSKVEKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITIN
PGCVVVDGMPPGVSFKAPSYLEISSMRRILDSAEFIKFTVIRPFPGLVINNQLVDQSESE
GPVIQESAEPSQLEVPATEEIKETDGSSQIKQEPDPTW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494C1K3	0.320	0.287	0.000	1159	1.000	0.861	A0A494C1K3.pdb.gz	A0A494C1K3_HUMAN General transcription factor IIi OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=1
2	AFDB:X5D2J9	0.575	0.595	0.000	957	0.958	0.999	X5D2J9.pdb.gz	X5D2J9_HUMAN General transcription factor IIi isoform D (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
3	AFDB:X5DNP5	0.294	0.299	0.000	978	0.979	0.999	X5DNP5.pdb.gz	X5DNP5_HUMAN General transcription factor IIi isoform B (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
4	AFDB:Q8AWX9	0.069	0.079	1.148E-4	806	0.108	0.134	Q8AWX9.pdb.gz
5	AFDB:A0A024RCR5	0.050	0.055	4.439E-4	801	0.101	0.126	A0A024RCR5.pdb.gz
6	AFDB:F8W3C9	0.060	0.068	1.626E-3	811	0.094	0.116	F8W3C9.pdb.gz
7	AFDB:A8CYQ7	0.053	0.060	1.812E-3	838	0.111	0.132	A8CYQ7.pdb.gz
8	AFDB:Q2M2Z5	0.045	0.061	5.779E-2	673	0.110	0.163	Q2M2Z5.pdb.gz	KIZ_HUMAN Centrosomal protein kizuna OS=Homo sapiens OX=9606 GN=KIZ PE=1 SV=2
9	AFDB:A4UZL3	0.045	0.041	9.927E-2	1141	0.126	0.110	A4UZL3.pdb.gz	A4UZL3_DROME Eps15 homology domain containing protein-binding protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Ehbp1 PE=1 SV=1
10	AFDB:O60885	0.056	0.047	1.233E-1	1362	0.094	0.069	O60885.pdb.gz	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
11	PDB:6ff4C	0.034	0.098	1.111	286	0.034	0.119	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
12	PDB:7p2eG	0.051	0.117	3.459	330	0.031	0.094	7p2eG.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
13	PDB:7c8jA	0.045	0.060	5.942	707	0.022	0.031	7c8jA.pdb.gz	Cross-species recognition of SARS-CoV-2 to bat ACE2.
14	PDB:7aoaD	0.027	0.052	6.273	343	0.025	0.073	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
15	PDB:4r8dA	0.037	0.072	6.990	369	0.008	0.022	4r8dA.pdb.gz	Crystal structure of Rv1600 encoded aminotransferase in complex with PLP-MES from Mycobacterium tuberculosis
16	PDB:1kx5A	0.036	0.156	7.378	135	0.017	0.126	1kx5A.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
17	PDB:2wvrC	0.038	0.141	7.378	172	0.010	0.058	2wvrC.pdb.gz
18	PDB:7pzyL	0.037	0.193	7.788	93	0.011	0.118	7pzyL.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
19	PDB:1jmoA	0.022	0.041	8.678	427	0.004	0.009	1jmoA.pdb.gz
20	PDB:5svaU	0.036	0.149	8.678	156	0.029	0.186	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C1K3	0.0	2038	1159	1.000	0.861	A0A494C1K3_HUMAN General transcription factor IIi OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=1
2	P78347	0.0	2034	998	1.000	1.000	GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2
3	Q5U2Y1	0.0	1930	979	0.954	0.972	GTF2I_RAT General transcription factor II-I OS=Rattus norvegicus OX=10116 GN=Gtf2i PE=1 SV=2
4	Q9ESZ8	0.0	1967	998	0.971	0.971	GTF2I_MOUSE General transcription factor II-I OS=Mus musculus OX=10090 GN=Gtf2i PE=1 SV=3
5	X5D2J9	0.0	1928	957	0.959	1.000	X5D2J9_HUMAN General transcription factor IIi isoform D (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
6	X5D939	0.0	1980	977	0.979	1.000	X5D939_HUMAN General transcription factor IIi isoform C (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
7	X5DNP5	0.0	1982	978	0.980	1.000	X5DNP5_HUMAN General transcription factor IIi isoform B (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
8	X5DR09	0.0	2034	998	1.000	1.000	X5DR09_HUMAN General transcription factor IIi isoform A (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
9	Q86UP8	7.14e-150	471	949	0.267	0.280	GTD2A_HUMAN General transcription factor II-I repeat domain-containing protein 2A OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=3
10	Q6EKJ0	8.91e-150	471	949	0.267	0.280	GTD2B_HUMAN General transcription factor II-I repeat domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
11	A0A494C1N8	2.43e-148	472	1116	0.269	0.240	A0A494C1N8_HUMAN GTF2I repeat domain containing 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
12	A0A494C0I1	5.68e-148	471	1111	0.267	0.239	A0A494C0I1_HUMAN GTF2I repeat domain containing 2 OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=1
13	Q99NI3	8.37e-116	380	936	0.219	0.234	GT2D2_MOUSE General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1
14	Q9UHL9	3.97e-113	374	959	0.296	0.308	GT2D1_HUMAN General transcription factor II-I repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GTF2IRD1 PE=1 SV=1
15	E9PFE2	4.18e-111	368	960	0.293	0.304	E9PFE2_HUMAN GTF2I repeat domain containing 1 OS=Homo sapiens OX=9606 GN=GTF2IRD1 PE=1 SV=1
16	Q9JI57	4.62e-84	296	1104	0.238	0.216	GT2D1_MOUSE General transcription factor II-I repeat domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gtf2ird1 PE=2 SV=2
17	B7ZQJ9	6.73e-73	263	993	0.196	0.197	GT2D1_XENLA General transcription factor II-I repeat domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=gtf2ird1 PE=1 SV=1
18	Q9LTM0	3.6	33.9	501	0.029	0.058	C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana OX=3702 GN=CYP71B23 PE=2 SV=1
19	Q9TW65	5.1	33.5	3674	0.030	0.008	DMD_CAEEL Dystrophin-1 OS=Caenorhabditis elegans OX=6239 GN=dys-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02946 GTF2I	1.4e-181	600.4	GTF2I-like repeat
2	PF16727 REV1_C	24	16.7	DNA repair protein REV1 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000460070

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357000	0.993	Upstream stimulatory factor 1
2	9606.ENSP00000483570	0.992	Tyrosine-protein kinase BTK
3	9606.ENSP00000363092	0.961	cGMP-dependent protein kinase 1
4	9606.ENSP00000479618	0.902	Myc proto-oncogene protein
5	9606.ENSP00000375942	0.884	TATA-box-binding protein
6	9606.ENSP00000302967	0.862	Histone deacetylase 3
7	9606.ENSP00000397566	0.846	General transcription factor II-I repeat domain-containing protein 1
8	9606.ENSP00000322845	0.842	Zinc finger MYM-type protein 3
9	9606.ENSP00000264399	0.838	cGMP-dependent protein kinase 2
10	9606.ENSP00000465676	0.833	E3 SUMO-protein ligase PIAS2
11	9606.ENSP00000235310	0.828	Mitotic spindle assembly checkpoint protein MAD2B
12	9606.ENSP00000430432	0.806	Histone deacetylase 2
13	9606.ENSP00000262238	0.786	Transcriptional repressor protein YY1
14	9606.ENSP00000356919	0.778	Cyclic AMP-dependent transcription factor ATF-6 alpha
15	9606.ENSP00000262160	0.777	Mothers against decapentaplegic homolog 2
16	9606.ENSP00000385720	0.777	Rho GTPase-activating protein 35
17	9606.ENSP00000363436	0.764	G protein-regulated inducer of neurite outgrowth 2
18	9606.ENSP00000377197	0.764	Hydrocephalus-inducing protein homolog
19	9606.ENSP00000474456	0.764	Neuroblastoma breakpoint family member 1
20	9606.ENSP00000320401	0.762	UDP-glucuronosyltransferase 2B17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	0.998	transcription factor binding
GO:0001216	0.998	DNA-binding transcription activator activity
GO:0097159	0.947	organic cyclic compound binding
GO:1901363	0.946	heterocyclic compound binding
GO:0003676	0.934	nucleic acid binding
GO:0140297	0.895	DNA-binding transcription factor binding
GO:0061629	0.809	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000981	0.801	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.749	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677	0.698	DNA binding
GO:0043565	0.533	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0050789	0.985	regulation of biological process
GO:0050794	0.976	regulation of cellular process
GO:0060255	0.955	regulation of macromolecule metabolic process
GO:0051171	0.954	regulation of nitrogen compound metabolic process
GO:0031323	0.954	regulation of cellular metabolic process
GO:0080090	0.953	regulation of primary metabolic process
GO:0048518	0.896	positive regulation of biological process
GO:0010468	0.858	regulation of gene expression
GO:0048519	0.840	negative regulation of biological process
GO:0010556	0.839	regulation of macromolecule biosynthetic process
GO:0031326	0.838	regulation of cellular biosynthetic process
GO:0051252	0.835	regulation of RNA metabolic process
GO:0048522	0.829	positive regulation of cellular process
GO:0006355	0.759	regulation of DNA-templated transcription
GO:0009893	0.729	positive regulation of metabolic process
GO:0010604	0.721	positive regulation of macromolecule metabolic process
GO:0051173	0.641	positive regulation of nitrogen compound metabolic process
GO:0031325	0.638	positive regulation of cellular metabolic process
GO:0006357	0.623	regulation of transcription by RNA polymerase II
GO:0045935	0.607	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.605	positive regulation of macromolecule biosynthetic process
GO:0031328	0.605	positive regulation of cellular biosynthetic process
GO:0045893	0.599	positive regulation of DNA-templated transcription
GO:0045944	0.535	positive regulation of transcription by RNA polymerase II
GO:0051239	0.419	regulation of multicellular organismal process
GO:0048523	0.350	negative regulation of cellular process
GO:0009987	0.348	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.383	protein-containing complex
GO:0016020	0.372	membrane
GO:0005737	0.368	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]