StarFunc result for job id P78356

User Input

>input (416 residues)
MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNV
PVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNS
VTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLL
PQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEE
RAEDEECENDGVGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKK
EVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78356	1.000	1.000	5.815E-81	416	1.000	1.000	P78356.pdb.gz	PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B PE=1 SV=1
2	AFDB:P48426	0.922	0.944	3.291E-67	406	0.752	0.771	P48426.pdb.gz	PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens OX=9606 GN=PIP4K2A PE=1 SV=2
3	AFDB:B3DJ34	0.885	0.911	1.349E-66	404	0.736	0.757	B3DJ34.pdb.gz	B3DJ34_DANRE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Danio rerio OX=7955 GN=LOC560360 PE=1 SV=1
4	AFDB:A0A2R8RVI8	0.906	0.864	2.720E-64	437	0.728	0.693	A0A2R8RVI8.pdb.gz
5	AFDB:Q8TBX8	0.853	0.842	1.966E-58	421	0.639	0.632	Q8TBX8.pdb.gz	PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C PE=1 SV=3
6	AFDB:Q8SXX1	0.865	0.890	3.384E-55	404	0.550	0.567	Q8SXX1.pdb.gz	Q8SXX1_DROME Phosphatidylinositol 5-phosphate 4-kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=PIP4K PE=1 SV=1
7	PDB:6ym4A	0.759	0.979	1.213E-52	322	0.606	0.783	6ym4A.pdb.gz	Discovery and Characterization of the Potent and Highly Selective 1,7-Naphthyridine-Based Inhibitors BAY-091 and BAY-297 of the Kinase PIP4K2A.
8	PDB:1bo1A	0.755	0.958	3.166E-52	326	0.757	0.966	1bo1A.pdb.gz
9	PDB:7em5B	0.702	0.980	2.310E-50	297	0.704	0.987	7em5B.pdb.gz	The GTP responsiveness of PI5P4K beta evolved from a compromised trade-off between activity and specificity.
10	PDB:7n81B	0.700	0.942	3.628E-50	307	0.728	0.987	7n81B.pdb.gz	Pharmacological inhibition of PI5P4K alpha / beta disrupts cell energy metabolism and selectively kills p53-null tumor cells.
11	AFDB:A0A2R8QMJ9	0.707	0.506	8.916E-35	592	0.300	0.211	A0A2R8QMJ9.pdb.gz
12	AFDB:Q9W2R3	0.734	0.401	1.324E-34	792	0.291	0.153	Q9W2R3.pdb.gz	Q9W2R3_DROME LP03320p OS=Drosophila melanogaster OX=7227 GN=sktl PE=1 SV=2
13	AFDB:Q99755	0.692	0.521	1.339E-33	562	0.296	0.219	Q99755.pdb.gz	PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1
14	AFDB:Q503I3	0.685	0.517	1.417E-33	559	0.291	0.216	Q503I3.pdb.gz	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
15	PDB:2gk9B	0.589	0.973	1.484E-30	250	0.430	0.716	2gk9B.pdb.gz
16	PDB:6fadC	0.210	0.238	8.455E-2	359	0.041	0.047	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
17	PDB:2rsvA	0.154	0.159	1.060E-1	403	0.022	0.022	2rsvA.pdb.gz
18	PDB:5n47A	0.075	0.127	1.060E-1	180	0.046	0.106	5n47A.pdb.gz
19	PDB:2ahcA	0.071	0.160	1.255E-1	164	0.050	0.128	2ahcA.pdb.gz	Structural analysis of ligand binding and catalysis in chorismate lyase
20	PDB:5dykA	0.166	0.097	1.761E-1	809	0.046	0.023	5dykA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DJ34	0.0	609	404	0.731	0.752	B3DJ34_DANRE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Danio rerio OX=7955 GN=LOC560360 PE=1 SV=1
2	O70172	0.0	608	405	0.752	0.773	PI42A_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Mus musculus OX=10090 GN=Pip4k2a PE=1 SV=1
3	P48426	0.0	611	406	0.755	0.773	PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens OX=9606 GN=PIP4K2A PE=1 SV=2
4	P78356	0.0	869	416	1.000	1.000	PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B PE=1 SV=1
5	Q80XI4	0.0	863	416	0.990	0.990	PI42B_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Mus musculus OX=10090 GN=Pip4k2b PE=1 SV=1
6	Q8TBX8	0.0	524	421	0.656	0.648	PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C PE=1 SV=3
7	O88370	5.67e-174	494	420	0.630	0.624	PI42C_RAT Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Rattus norvegicus OX=10116 GN=Pip4k2c PE=1 SV=1
8	Q8SXX1	3.26e-156	448	404	0.558	0.574	Q8SXX1_DROME Phosphatidylinositol 5-phosphate 4-kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=PIP4K PE=1 SV=1
9	Q55GN6	5.43e-56	198	719	0.300	0.174	Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0267588 PE=1 SV=1
10	P38994	2.34e-51	186	779	0.312	0.167	MSS4_YEAST Phosphatidylinositol 4-phosphate 5-kinase MSS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSS4 PE=1 SV=2
11	O14986	9.95e-49	175	540	0.305	0.235	PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens OX=9606 GN=PIP5K1B PE=1 SV=2
12	P70181	1.67e-47	172	539	0.308	0.237	PI51B_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Mus musculus OX=10090 GN=Pip5k1b PE=1 SV=1
13	Q99755	4.49e-46	169	562	0.303	0.224	PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1
14	A6PW57	5.06e-46	168	550	0.303	0.229	A6PW57_HUMAN Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=2
15	Q581R9	3.25e-45	165	481	0.269	0.233	Q581R9_TRYB2 Phosphatidylinositol 4-phosphate 5-kinase alpha, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.1030 PE=4 SV=1
16	A0A1D8PJ31	5.22e-45	167	718	0.305	0.177	A0A1D8PJ31_CANAL 1-phosphatidylinositol-4-phosphate 5-kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSS4 PE=4 SV=1
17	D3ZSI8	1.02e-44	164	546	0.298	0.227	PI51A_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Rattus norvegicus OX=10116 GN=Pip5k1a PE=1 SV=1
18	Q503I3	2.08e-44	164	559	0.286	0.213	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
19	O13853	3.66e-44	166	742	0.286	0.160	ITS3_SCHPO Phosphatidylinositol 4-phosphate 5-kinase its3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=its3 PE=1 SV=3
20	O60331	1.30e-43	163	668	0.300	0.187	PI51C_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Homo sapiens OX=9606 GN=PIP5K1C PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01504 PIP5K	3.4e-74	261.1	Phosphatidylinositol-4-phosphate 5-Kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000708

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000003404	0.995	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
2	61853.ENSNLEP00000005370	0.995	Phospholipase C, zeta 1
3	61853.ENSNLEP00000005986	0.995	Phospholipase C, beta 3 (phosphatidylinositol-specific)
4	61853.ENSNLEP00000006323	0.995	Phospholipase C, delta 1
5	61853.ENSNLEP00000007890	0.995	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
6	61853.ENSNLEP00000010681	0.995	Phospholipase C, delta 4
7	61853.ENSNLEP00000010775	0.995	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
8	61853.ENSNLEP00000015717	0.995	Phospholipase C, epsilon 1
9	61853.ENSNLEP00000017309	0.995	Phospholipase C, beta 1 (phosphoinositide-specific)
10	61853.ENSNLEP00000005291	0.989	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta
11	61853.ENSNLEP00000006936	0.989	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha
12	61853.ENSNLEP00000002916	0.987	Catalyzes the hydrolysis of phosphatidylinositol-4,5- bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P)
13	61853.ENSNLEP00000017460	0.987	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
14	61853.ENSNLEP00000020224	0.987	Phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
15	61853.ENSNLEP00000004198	0.986	Myotubularin related protein 3
16	61853.ENSNLEP00000004772	0.986	Phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
17	61853.ENSNLEP00000004900	0.986	Myotubularin related protein 14
18	61853.ENSNLEP00000007175	0.986	Uncharacterized protein
19	61853.ENSNLEP00000013307	0.986	Catalyzes the hydrolysis of phosphatidylinositol-4,5- bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P)
20	61853.ENSNLEP00000000272	0.985	Phospholipase C, eta 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016308	1.000	1-phosphatidylinositol-4-phosphate 5-kinase activity
GO:0042802	0.993	identical protein binding
GO:0046983	0.572	protein dimerization activity
GO:0042803	0.459	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.984	primary metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0044237	0.984	cellular metabolic process
GO:0006629	0.974	lipid metabolic process
GO:0010506	0.966	regulation of autophagy
GO:0046488	0.961	phosphatidylinositol metabolic process
GO:0046854	0.926	phosphatidylinositol phosphate biosynthetic process
GO:0044088	0.922	regulation of vacuole organization
GO:1902115	0.898	regulation of organelle assembly
GO:1900076	0.895	regulation of cellular response to insulin stimulus
GO:0019220	0.893	regulation of phosphate metabolic process
GO:0016241	0.893	regulation of macroautophagy
GO:1902117	0.887	positive regulation of organelle assembly
GO:0042325	0.869	regulation of phosphorylation
GO:0016192	0.850	vesicle-mediated transport
GO:0051338	0.839	regulation of transferase activity
GO:2000785	0.839	regulation of autophagosome assembly
GO:0046626	0.836	regulation of insulin receptor signaling pathway
GO:1900077	0.836	negative regulation of cellular response to insulin stimulus
GO:0006914	0.835	autophagy
GO:0043550	0.833	regulation of lipid kinase activity
GO:0010508	0.828	positive regulation of autophagy
GO:0016239	0.823	positive regulation of macroautophagy
GO:0080090	0.787	regulation of primary metabolic process
GO:0061024	0.767	membrane organization
GO:0019216	0.722	regulation of lipid metabolic process
GO:0048284	0.658	organelle fusion
GO:0045936	0.628	negative regulation of phosphate metabolic process
GO:0016050	0.624	vesicle organization
GO:0050896	0.620	response to stimulus
GO:0046627	0.589	negative regulation of insulin receptor signaling pathway
GO:0045833	0.577	negative regulation of lipid metabolic process
GO:0042326	0.575	negative regulation of phosphorylation
GO:0043086	0.505	negative regulation of catalytic activity
GO:0033673	0.501	negative regulation of kinase activity
GO:0051716	0.458	cellular response to stimulus
GO:0007154	0.440	cell communication
GO:0023052	0.435	signaling
GO:0007165	0.419	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.998	plasma membrane
GO:0005654	0.996	nucleoplasm
GO:0005773	0.944	vacuole
GO:0005776	0.877	autophagosome
GO:0012505	0.739	endomembrane system
GO:0031982	0.369	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14425	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ADP + H(+)
EC:2.7.1.68	1.000	1-phosphatidylinositol-4-phosphate 5-kinase.

[back to server]