StarFunc result for job id P78357

User Input

>input (1384 residues)
MMHLRLFCILLAAVSGAEGWGYYGCDEELVGPLYARSLGASSYYSLLTAPRFARLHGISG
WSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHN
STFFGNVNESAVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGD
DAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGS
SPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTE
MFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCLDPVP
HPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSRLGDGLGHVELTLSEGQVN
VSIAQSGRKKLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTGT
SYFFGGCPKPASRWDCHSNQTAFHGCMELLKVDGQLVNLTLVEGRRLGFYAEVLFDTCGI
TDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGETCHTPLYKESCEAYRLSGKTSGNFTI
DPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAIQYWNASWEEVS
ALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGLD
RSCVDPALYCNCDADQPQWRTDKGLLTFVDHLPVTQVVIGDTNRSTSEAQFFLRPLRCYG
DRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPYCQWRRPYVRV
ELNTSRDVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLRP
MPLQTYIWMEYDQPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTSPNCTGH
CAHPRLPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSA
AREFSHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPDYPRPGRPVPGYRGPVYNVT
GEEVSFSFSTSSAPAVLLYVSSFVRDYMAVLIKDDGTLQLRYQLGTSPYVYQLTTRPVTD
GQPHSINITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQR
YNTPGFSGCLSGVRFNNVAPLKTHFRTPRPMTAELAEALRVQGELSESNCGAMPRLVSEV
PPELDPWYLPPDFPYYHDEGWVAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNEP
KAAHEYHPGSKPPLPTSGPAQVPTPTAAPNQAPASAPAPAPTPAPAPGPRDQNLPQILEE
SRSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PY62	0.622	0.666	0.000	1287	0.326	0.350	E9PY62.pdb.gz	E9PY62_MOUSE Contactin associated protein-like 3 OS=Mus musculus OX=10090 GN=Cntnap3 PE=1 SV=1
2	AFDB:O54991	0.840	0.839	0.000	1385	0.933	0.932	O54991.pdb.gz	CNTP1_MOUSE Contactin-associated protein 1 OS=Mus musculus OX=10090 GN=Cntnap1 PE=1 SV=2
3	AFDB:Q94887	0.662	0.707	0.000	1284	0.275	0.297	Q94887.pdb.gz	NRX4_DROME Neurexin-4 OS=Drosophila melanogaster OX=7227 GN=Nrx-IV PE=1 SV=2
4	AFDB:Q99P47	0.613	0.645	0.000	1310	0.350	0.369	Q99P47.pdb.gz	CNTP4_MOUSE Contactin-associated protein-like 4 OS=Mus musculus OX=10090 GN=Cntnap4 PE=1 SV=2
5	AFDB:Q9C0A0	0.606	0.639	0.000	1308	0.355	0.375	Q9C0A0.pdb.gz	CNTP4_HUMAN Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3
6	AFDB:Q9CPW0	0.628	0.651	0.000	1332	0.418	0.434	Q9CPW0.pdb.gz	CNTP2_MOUSE Contactin-associated protein-like 2 OS=Mus musculus OX=10090 GN=Cntnap2 PE=1 SV=2
7	AFDB:Q19617	0.592	0.681	5.740E-73	1180	0.197	0.231	Q19617.pdb.gz	NLR1_CAEEL Neurexin like receptor 1 OS=Caenorhabditis elegans OX=6239 GN=nlr-1 PE=1 SV=3
8	AFDB:M9PE65	0.328	0.228	1.274E-71	2179	0.211	0.134	M9PE65.pdb.gz	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
9	AFDB:Q6P9K9	0.171	0.153	1.475E-60	1571	0.196	0.173	Q6P9K9.pdb.gz	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
10	AFDB:Q9Y4C0	0.169	0.146	1.583E-59	1643	0.194	0.164	Q9Y4C0.pdb.gz	NRX3A_HUMAN Neurexin-3 OS=Homo sapiens OX=9606 GN=NRXN3 PE=1 SV=4
11	PDB:4bxsV	0.098	0.107	5.690E-8	1262	0.035	0.039	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
12	PDB:7kveB	0.098	0.099	1.688E-6	1374	0.040	0.041	7kveB.pdb.gz
13	PDB:4pbpB	0.099	0.555	3.326E-6	210	0.020	0.133	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
14	PDB:3jd6O	0.096	0.717	5.144E-6	167	0.033	0.269	3jd6O.pdb.gz
15	PDB:2vmeA	0.090	0.461	5.399E-6	256	0.034	0.184	2vmeA.pdb.gz	Structure Determination of Discoidin II from Dictyostelium Discoideum and Carbohydrate Binding Properties of the Lectin Domain.
16	PDB:2w94A	0.098	0.504	5.667E-6	254	0.036	0.197	2w94A.pdb.gz	Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
17	PDB:7zl1A	0.101	0.548	8.763E-6	215	0.017	0.112	7zl1A.pdb.gz
18	PDB:3ffzA	0.087	0.094	2.199E-5	1246	0.029	0.032	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
19	PDB:6m5yA	0.068	0.263	3.240E-5	270	0.027	0.141	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
20	PDB:3v0aB	0.097	0.114	1.036E-4	1150	0.025	0.030	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GH02	0.0	1137	1332	0.418	0.434	A0A8I6GH02_RAT Contactin associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cntnap2 PE=3 SV=1
2	D8WUA6	0.0	1141	1328	0.416	0.434	D8WUA6_TAEGU Contactin associated protein-like 2 OS=Taeniopygia guttata OX=59729 GN=CNTNAP2 PE=2 SV=1
3	E9PY62	0.0	845	1287	0.309	0.332	E9PY62_MOUSE Contactin associated protein-like 3 OS=Mus musculus OX=10090 GN=Cntnap3 PE=1 SV=1
4	O54991	0.0	2627	1385	0.934	0.933	CNTP1_MOUSE Contactin-associated protein 1 OS=Mus musculus OX=10090 GN=Cntnap1 PE=1 SV=2
5	P78357	0.0	2867	1384	1.000	1.000	CNTP1_HUMAN Contactin-associated protein 1 OS=Homo sapiens OX=9606 GN=CNTNAP1 PE=1 SV=1
6	P97846	0.0	2664	1381	0.934	0.936	CNTP1_RAT Contactin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Cntnap1 PE=1 SV=1
7	Q99P47	0.0	890	1310	0.351	0.371	CNTP4_MOUSE Contactin-associated protein-like 4 OS=Mus musculus OX=10090 GN=Cntnap4 PE=1 SV=2
8	Q9C0A0	0.0	929	1308	0.357	0.378	CNTP4_HUMAN Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3
9	Q9CPW0	0.0	1139	1332	0.416	0.432	CNTP2_MOUSE Contactin-associated protein-like 2 OS=Mus musculus OX=10090 GN=Cntnap2 PE=1 SV=2
10	Q9UHC6	0.0	1144	1331	0.417	0.434	CNTP2_HUMAN Contactin-associated protein-like 2 OS=Homo sapiens OX=9606 GN=CNTNAP2 PE=1 SV=1
11	Q94887	6.66e-169	541	1284	0.267	0.288	NRX4_DROME Neurexin-4 OS=Drosophila melanogaster OX=7227 GN=Nrx-IV PE=1 SV=2
12	Q3URC6	3.24e-76	264	510	0.107	0.290	Q3URC6_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Cntnap3 PE=2 SV=1
13	M9PE65	7.80e-54	210	2179	0.150	0.095	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
14	Q19617	2.90e-52	204	1180	0.173	0.203	NLR1_CAEEL Neurexin like receptor 1 OS=Caenorhabditis elegans OX=6239 GN=nlr-1 PE=1 SV=3
15	Q9XYX0	3.71e-45	181	1685	0.165	0.136	Q9XYX0_DROME AXO OS=Drosophila melanogaster OX=7227 GN=axo PE=2 SV=1
16	A1XQX4	3.03e-34	146	1670	0.092	0.077	A1XQX4_DANRE Neurexin 2a alpha OS=Danio rerio OX=7955 GN=nrxn2a PE=2 SV=1
17	A0A0R4J2G7	2.59e-32	139	1495	0.085	0.079	A0A0R4J2G7_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
18	A0A1D5RMU6	3.10e-32	139	1499	0.085	0.079	A0A1D5RMU6_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
19	E7ERL8	4.85e-30	132	1507	0.087	0.080	E7ERL8_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
20	Q9ULB1	5.39e-30	132	1477	0.087	0.081	NRX1A_HUMAN Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	0.0013	30.3	EGF-like domain
2	PF00754 F5_F8_type_C	3.7e-18	77.3	F5/8 type C domain
3	PF00054 Laminin_G_1	2.4e-57	204.2	Laminin G domain
4	PF02210 Laminin_G_2	3.2e-88	304.1	Laminin G domain
5	PF13385 Laminin_G_3	0.084	24.4	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264638

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344786	0.998	Neurofascin
2	9606.ENSP00000447006	0.997	Contactin-1
3	9606.ENSP00000343158	0.991	Band 4.1-like protein 3
4	9606.ENSP00000330633	0.895	Contactin-2
5	9606.ENSP00000371985	0.888	Potassium voltage-gated channel subfamily A member 1
6	9606.ENSP00000346534	0.875	Sodium channel protein type 8 subunit alpha
7	9606.ENSP00000433109	0.872	Potassium voltage-gated channel subfamily A member 2
8	9606.ENSP00000345259	0.825	Protein 4.1
9	9606.ENSP00000380958	0.806	Myelin basic protein
10	9606.ENSP00000263713	0.796	Band 4.1-like protein 5
11	9606.ENSP00000435637	0.787	Contactin-5
12	9606.ENSP00000263373	0.778	Spectrin beta chain, non-erythrocytic 4
13	9606.ENSP00000335196	0.774	Gliomedin
14	9606.ENSP00000368314	0.765	Neuronal cell adhesion molecule
15	9606.ENSP00000337443	0.764	Nucleoredoxin
16	9606.ENSP00000280772	0.744	Ankyrin-3
17	9606.ENSP00000344666	0.741	Merlin
18	9606.ENSP00000377047	0.739	Receptor-type tyrosine-protein phosphatase zeta
19	9606.ENSP00000355607	0.738	Glyceronephosphate O-acyltransferase
20	9606.ENSP00000365569	0.728	Flotillin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0032502	0.987	developmental process
GO:0032501	0.985	multicellular organismal process
GO:0042552	0.983	myelination
GO:0007043	0.981	cell-cell junction assembly
GO:0032989	0.978	cellular component morphogenesis
GO:0065007	0.970	biological regulation
GO:0050789	0.946	regulation of biological process
GO:0050794	0.918	regulation of cellular process
GO:0010927	0.909	cellular component assembly involved in morphogenesis
GO:0007154	0.823	cell communication
GO:0048858	0.719	cell projection morphogenesis
GO:0030154	0.716	cell differentiation
GO:0042063	0.655	gliogenesis
GO:0010001	0.637	glial cell differentiation
GO:0032291	0.620	axon ensheathment in central nervous system
GO:0021782	0.539	glial cell development
GO:0031175	0.485	neuron projection development
GO:0007417	0.394	central nervous system development
GO:0050896	0.340	response to stimulus
GO:0051179	0.331	localization
GO:0023052	0.309	signaling
GO:0014003	0.309	oligodendrocyte development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0030054	0.982	cell junction
GO:0120025	0.890	plasma membrane bounded cell projection
GO:0043005	0.837	neuron projection
GO:0030424	0.797	axon
GO:0044304	0.771	main axon
GO:0033270	0.739	paranode region of axon
GO:0045202	0.732	synapse
GO:0005737	0.719	cytoplasm
GO:0043227	0.703	membrane-bounded organelle
GO:0043229	0.636	intracellular organelle
GO:0005911	0.398	cell-cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]