StarFunc result for job id P78364

User Input

>input (1004 residues)
METESEQNSNSTNGSSSSGGSSRPQIAQMSLYERQAVQALQALQRQPNAAQYFHQFMLQQ
QLSNAQLHSLAAVQQATIAASRQASSPNTSTTQQQTTTTQASINLATTSAAQLISRSQSV
SSPSATTLTQSVLLGNTTSPPLNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPN
GAVAAVQQEVPSAQSPGVHADADQVQNLAVRNQQASAQGPQMQGSTQKAIPPGASPVSSL
SQASSQALAVAQASSGATNQSLNLSQAGGGSGNSIPGSMGPGGGGQAHGGLGQLPSSGMG
GGSCPRKGTGVVQPLPAAQTVTVSQGSQTEAESAAAKKAEADGSGQQNVGMNLTRTATPA
PSQTLISSATYTQIQPHSLIQQQQQIHLQQKQVVIQQQIAIHHQQQFQHRQSQLLHTATH
LQLAQQQQQQQQQQQQQQQPQATTLTAPQPPQVPPTQQVPPSQSQQQAQTLVVQPMLQSS
PLSLPPDAAPKPPIPIQSKPPVAPIKPPQLGAAKMSAAQQPPPHIPVQVVGTRQPGTAQA
QALGLAQLAAAVPTSRGMPGTVQSGQAHLASSPPSSQAPGALQECPPTLAPGMTLAPVQG
TAHVVKGGATTSSPVVAQVPAAFYMQSVHLPGKPQTLAVKRKADSEEERDDVSTLGSMLP
AKASPVAESPKVMDEKSSLGEKAESVANVNANTPSSELVALTPAPSVPPPTLAMVSRQMG
DSKPPQAIVKPQILTHIIEGFVIQEGAEPFPVGCSQLLKESEKPLQTGLPTGLTENQSGG
PLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRK
KMKEFQEANYARVRRRGPRRSSSDIARAKIQGKCHRGQEDSSRGSDNSSYDEALSPTSPG
PLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRWSVEEVYEFIASLQGCQEIAE
EFRSQEIDGQALLLLKEEHLMSAMNIKLGPALKICAKINVLKET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q59GP6	0.105	0.099	0.000	1099	0.999	0.913	Q59GP6.pdb.gz	Q59GP6_HUMAN Polyhomeotic-like protein 1 variant (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:Q8NDX5	0.090	0.092	3.345E-25	983	0.310	0.316	Q8NDX5.pdb.gz	PHC3_HUMAN Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3 PE=1 SV=1
3	AFDB:Q8IXK0	0.110	0.123	9.589E-25	858	0.338	0.395	Q8IXK0.pdb.gz	PHC2_HUMAN Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
4	AFDB:Q9QWH1	0.103	0.116	7.879E-24	850	0.323	0.381	Q9QWH1.pdb.gz	PHC2_MOUSE Polyhomeotic-like protein 2 OS=Mus musculus OX=10090 GN=Phc2 PE=1 SV=1
5	AFDB:Q9W523	0.086	0.058	9.757E-15	1537	0.258	0.169	Q9W523.pdb.gz	Q9W523_DROME Polyhomeotic distal, isoform A OS=Drosophila melanogaster OX=7227 GN=ph-d PE=4 SV=3
6	AFDB:P39769	0.098	0.065	5.881E-14	1589	0.260	0.164	P39769.pdb.gz	PHP_DROME Polyhomeotic-proximal chromatin protein OS=Drosophila melanogaster OX=7227 GN=ph-p PE=1 SV=2
7	AFDB:E7EX82	0.055	0.064	3.434E-10	828	0.226	0.274	E7EX82.pdb.gz	E7EX82_HUMAN Polyhomeotic homolog 3 OS=Homo sapiens OX=9606 GN=PHC3 PE=1 SV=1
8	AFDB:O01585	0.043	0.039	2.198E-3	1085	0.132	0.123	O01585.pdb.gz	O01585_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rga-3 PE=1 SV=1
9	AFDB:Q9UPX8	0.071	0.049	2.816E-3	1470	0.166	0.114	Q9UPX8.pdb.gz	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
10	AFDB:Q55C49	0.065	0.065	4.622E-3	1006	0.140	0.140	Q55C49.pdb.gz	GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum OX=44689 GN=gtaG PE=4 SV=1
11	PDB:7anwA	0.063	0.098	2.086E-2	645	0.024	0.037	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
12	PDB:7cm7A	0.064	0.103	2.672E-2	620	0.021	0.034	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
13	PDB:3bs5A	0.065	0.698	4.667E-2	86	0.014	0.163	3bs5A.pdb.gz
14	PDB:6wpkA	0.064	0.116	5.620E-2	547	0.021	0.038	6wpkA.pdb.gz
15	PDB:6brhB	0.062	0.122	6.361E-2	502	0.016	0.032	6brhB.pdb.gz	The SAM domain of mouse SAMHD1 is critical for its activation and regulation.
16	PDB:3j6bW	0.037	0.191	2.459	112	0.018	0.161	3j6bW.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
17	PDB:3ldaA	0.056	0.175	2.961	293	0.009	0.031	3ldaA.pdb.gz
18	PDB:2w96A	0.034	0.107	3.566	249	0.014	0.056	2w96A.pdb.gz
19	PDB:2yfqB	0.027	0.055	3.566	397	0.010	0.025	2yfqB.pdb.gz
20	PDB:3j7a3	0.020	0.175	3.794	95	0.007	0.074	3j7a3.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KQH6	0.0	1878	959	0.955	1.000	J3KQH6_HUMAN Polyhomeotic homolog 1 OS=Homo sapiens OX=9606 GN=PHC1 PE=1 SV=1
2	P78364	0.0	1991	1004	1.000	1.000	PHC1_HUMAN Polyhomeotic-like protein 1 OS=Homo sapiens OX=9606 GN=PHC1 PE=1 SV=3
3	Q59GP6	0.0	1986	1099	0.999	0.913	Q59GP6_HUMAN Polyhomeotic-like protein 1 variant (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
4	Q64028	0.0	1436	1010	0.925	0.920	PHC1_MOUSE Polyhomeotic-like protein 1 OS=Mus musculus OX=10090 GN=Phc1 PE=1 SV=3
5	B3KPJ4	1.08e-76	261	464	0.157	0.341	B3KPJ4_HUMAN cDNA FLJ31867 fis, clone NT2RP7001856, highly similar to Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 PE=1 SV=1
6	B7ZLY0	1.25e-76	271	830	0.157	0.190	B7ZLY0_HUMAN PHC2 protein OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
7	A0A0A0MSI2	1.30e-76	271	830	0.157	0.190	A0A0A0MSI2_HUMAN Polyhomeotic homolog 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
8	Q8IXK0	1.79e-76	271	858	0.157	0.184	PHC2_HUMAN Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
9	Q8NDX5	6.80e-64	236	983	0.135	0.138	PHC3_HUMAN Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3 PE=1 SV=1
10	Q8CHP6	1.46e-61	229	981	0.131	0.135	PHC3_MOUSE Polyhomeotic-like protein 3 OS=Mus musculus OX=10090 GN=Phc3 PE=1 SV=2
11	P78365	2.68e-59	212	433	0.139	0.323	P78365_HUMAN Polyhomeotic 2 homolog OS=Homo sapiens OX=9606 GN=HPH2 PE=2 SV=1
12	E7EX82	1.73e-30	132	828	0.070	0.085	E7EX82_HUMAN Polyhomeotic homolog 3 OS=Homo sapiens OX=9606 GN=PHC3 PE=1 SV=1
13	Q9QWH1	7.87e-27	120	850	0.123	0.145	PHC2_MOUSE Polyhomeotic-like protein 2 OS=Mus musculus OX=10090 GN=Phc2 PE=1 SV=1
14	Q9W523	4.47e-20	99.4	1537	0.043	0.028	Q9W523_DROME Polyhomeotic distal, isoform A OS=Drosophila melanogaster OX=7227 GN=ph-d PE=4 SV=3
15	Q9NF31	4.86e-20	99.0	1359	0.043	0.032	Q9NF31_DROME EG:BACN25G24.3 protein (Fbgn0004860;ph-d protein) OS=Drosophila melanogaster OX=7227 GN=ph-d PE=4 SV=1
16	P39769	6.63e-20	98.6	1589	0.046	0.029	PHP_DROME Polyhomeotic-proximal chromatin protein OS=Drosophila melanogaster OX=7227 GN=ph-p PE=1 SV=2
17	Q8N228	4.96e-13	74.7	414	0.036	0.087	SCML4_HUMAN Sex comb on midleg-like protein 4 OS=Homo sapiens OX=9606 GN=SCML4 PE=1 SV=2
18	Q96NU1	5.88e-13	75.5	681	0.031	0.046	SAM11_HUMAN Sterile alpha motif domain-containing protein 11 OS=Homo sapiens OX=9606 GN=SAMD11 PE=1 SV=3
19	Q8C8Y5	7.20e-13	74.3	445	0.031	0.070	SAMD7_MOUSE Sterile alpha motif domain-containing protein 7 OS=Mus musculus OX=10090 GN=Samd7 PE=2 SV=4
20	Q9UQR0	8.40e-13	75.1	700	0.036	0.051	SCML2_HUMAN Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16616 PHC2_SAM_assoc	7.3e-16	70.4	Unstructured region on Polyhomeotic-like protein 1 and 2
2	PF00536 SAM_1	4.7e-13	60.7	SAM domain (Sterile alpha motif)
3	PF07647 SAM_2	1.7e-06	39.4	SAM domain (Sterile alpha motif)
4	PF02198 SAM_PNT	26	16.2	Sterile alpha motif (SAM)/Pointed domain
5	PF11706 zf-CGNR	9.3e+02	11.1	CGNR zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440674

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356480	0.999	E3 ubiquitin-protein ligase RING2
2	9606.ENSP00000365851	0.999	Polycomb complex protein BMI-1
3	9606.ENSP00000482063	0.998	Polycomb group RING finger protein 2
4	9606.ENSP00000363787	0.997	E3 ubiquitin-protein ligase RING1
5	9606.ENSP00000216133	0.996	Chromobox protein homolog 7
6	9606.ENSP00000269385	0.996	Chromobox protein homolog 8
7	9606.ENSP00000269397	0.996	E3 SUMO-protein ligase CBX4
8	9606.ENSP00000308750	0.996	Chromobox protein homolog 2
9	9606.ENSP00000473391	0.994	annotation not available
10	9606.ENSP00000257118	0.990	Polyhomeotic-like protein 2
11	9606.ENSP00000384490	0.988	Chromobox protein homolog 6
12	9606.ENSP00000420294	0.980	Polyhomeotic-like protein 3
13	9606.ENSP00000263360	0.977	Polycomb protein EED
14	9606.ENSP00000233630	0.975	Polycomb group RING finger protein 1
15	9606.ENSP00000318094	0.972	Polycomb protein SCMH1
16	9606.ENSP00000354724	0.970	Polycomb group RING finger protein 3
17	9606.ENSP00000358862	0.968	Polycomb group RING finger protein 6
18	9606.ENSP00000316578	0.960	Polycomb protein SUZ12
19	9606.ENSP00000320147	0.958	Histone-lysine N-methyltransferase EZH2
20	9606.ENSP00000445704	0.952	Polycomb group RING finger protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:0036211	0.978	protein modification process
GO:0016570	0.932	histone modification
GO:0009987	0.888	cellular process
GO:0050896	0.822	response to stimulus
GO:0032446	0.719	protein modification by small protein conjugation
GO:0065007	0.657	biological regulation
GO:0050789	0.645	regulation of biological process
GO:0032526	0.594	response to retinoic acid
GO:0016567	0.592	protein ubiquitination
GO:0019222	0.522	regulation of metabolic process
GO:0034097	0.504	response to cytokine
GO:0051716	0.442	cellular response to stimulus
GO:0050794	0.440	regulation of cellular process
GO:1990823	0.420	response to leukemia inhibitory factor
GO:0060255	0.417	regulation of macromolecule metabolic process
GO:0016574	0.349	histone ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.984	protein-containing complex
GO:0140513	0.914	nuclear protein-containing complex
GO:1990234	0.883	transferase complex
GO:0031519	0.791	PcG protein complex
GO:0140535	0.723	intracellular protein-containing complex
GO:0000151	0.665	ubiquitin ligase complex
GO:0000152	0.634	nuclear ubiquitin ligase complex
GO:0043232	0.547	intracellular non-membrane-bounded organelle
GO:0035102	0.502	PRC1 complex
GO:0005694	0.415	chromosome
GO:0005737	0.364	cytoplasm
GO:0000785	0.342	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]