StarFunc result for job id P78381

User Input

>input (396 residues)
MAAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTL
PGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSL
IYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVA
IVQAQQAGGGGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGL
FGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFA
TSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAIASASASASGPCV
HQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B4DE15	0.847	0.826	5.808E-43	406	0.970	0.946	B4DE15.pdb.gz	B4DE15_HUMAN Solute carrier family 35 member A2 OS=Homo sapiens OX=9606 GN=SLC35A2 PE=1 SV=1
2	AFDB:O76865	0.778	0.837	8.582E-25	368	0.434	0.467	O76865.pdb.gz	O76865_DROME EG:100G10.5 protein OS=Drosophila melanogaster OX=7227 GN=Ugalt PE=1 SV=1
3	AFDB:P87041	0.745	0.834	1.869E-22	353	0.384	0.431	P87041.pdb.gz	GMS1_SCHPO UDP-galactose transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gms1 PE=2 SV=3
4	AFDB:Q93890	0.770	0.828	4.081E-22	368	0.359	0.386	Q93890.pdb.gz	SRF3_CAEEL UDP-galactose/UDP-N-acetylglucosamine transporter srf-3 OS=Caenorhabditis elegans OX=6239 GN=srf-3 PE=1 SV=5
5	AFDB:Q5K8Q8	0.720	0.413	1.582E-20	703	0.396	0.223	Q5K8Q8.pdb.gz	Q5K8Q8_CRYNJ Solute carrier family 35 (UDP-sugar transporter), member A1/2/3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CNL04830 PE=4 SV=2
6	AFDB:O77592	0.631	0.754	2.110E-20	326	0.419	0.509	O77592.pdb.gz	S35A3_CANLF UDP-N-acetylglucosamine transporter OS=Canis lupus familiaris OX=9615 GN=SLC35A3 PE=2 SV=1
7	PDB:6xboA	0.647	0.789	1.818E-19	319	0.359	0.445	6xboA.pdb.gz	Inhibition of CMP-sialic acid transport by endogenous 5-methyl CMP.
8	AFDB:P78382	0.652	0.756	2.810E-19	337	0.361	0.424	P78382.pdb.gz	S35A1_HUMAN CMP-sialic acid transporter OS=Homo sapiens OX=9606 GN=SLC35A1 PE=1 SV=1
9	AFDB:Q02334	0.635	0.700	1.572E-14	355	0.270	0.301	Q02334.pdb.gz	UGTP1_CAEEL UDP-galactose translocator 1 OS=Caenorhabditis elegans OX=6239 GN=ugtp-1 PE=3 SV=2
10	AFDB:Q388K9	0.622	0.679	2.911E-14	359	0.295	0.326	Q388K9.pdb.gz	Q388K9_TRYB2 UDP-galactose transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.3010 PE=4 SV=1
11	AFDB:F4JN00	0.627	0.697	6.615E-13	352	0.247	0.278	F4JN00.pdb.gz	CSTR4_ARATH CMP-sialic acid transporter 4 OS=Arabidopsis thaliana OX=3702 GN=At4g35335 PE=2 SV=1
12	PDB:5ogeG	0.485	0.599	2.812E-5	306	0.101	0.131	5ogeG.pdb.gz
13	PDB:5j4nA	0.199	0.189	3.737E-2	437	0.121	0.110	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
14	PDB:7p9uB	0.207	0.188	7.514E-2	455	0.144	0.125	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
15	PDB:7ccsB	0.146	0.134	1.088E-1	454	0.157	0.137	7ccsB.pdb.gz
16	PDB:7b4mA	0.106	0.097	1.856E-1	459	0.162	0.139	7b4mA.pdb.gz
17	PDB:7t9gA	0.118	0.109	2.188E-1	445	0.126	0.112	7t9gA.pdb.gz	Structural basis of ion - substrate coupling in the Na + -dependent dicarboxylate transporter VcINDY.
18	PDB:4k1cA	0.170	0.175	2.475E-1	374	0.093	0.099	4k1cA.pdb.gz	Structural basis for alternating access of a eukaryotic calcium/proton exchanger.
19	PDB:5xezB	0.125	0.110	3.299E-1	499	0.121	0.096	5xezB.pdb.gz	Structure of the full-length glucagon class B G-protein-coupled receptor.
20	PDB:3lrbA	0.183	0.179	3.732E-1	410	0.134	0.129	3lrbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DE15	0.0	755	406	0.980	0.956	B4DE15_HUMAN Solute carrier family 35 member A2 OS=Homo sapiens OX=9606 GN=SLC35A2 PE=1 SV=1
2	P78381	0.0	779	396	1.000	1.000	S35A2_HUMAN UDP-galactose translocator OS=Homo sapiens OX=9606 GN=SLC35A2 PE=1 SV=1
3	Q9R0M8	0.0	726	390	0.937	0.951	S35A2_MOUSE UDP-galactose translocator OS=Mus musculus OX=10090 GN=Slc35a2 PE=1 SV=1
4	O76865	6.92e-102	308	368	0.429	0.462	O76865_DROME EG:100G10.5 protein OS=Drosophila melanogaster OX=7227 GN=Ugalt PE=1 SV=1
5	Q9Y2D2	7.86e-102	306	325	0.427	0.520	S35A3_HUMAN UDP-N-acetylglucosamine transporter OS=Homo sapiens OX=9606 GN=SLC35A3 PE=1 SV=1
6	O77592	2.51e-101	305	326	0.429	0.521	S35A3_CANLF UDP-N-acetylglucosamine transporter OS=Canis lupus familiaris OX=9615 GN=SLC35A3 PE=2 SV=1
7	Q9W4W6	1.73e-100	304	357	0.417	0.462	Q9W4W6_DROME CMP-sialic acid/UDP-galactose transporter OS=Drosophila melanogaster OX=7227 GN=Ugalt PE=1 SV=1
8	P78382	3.16e-87	270	337	0.369	0.433	S35A1_HUMAN CMP-sialic acid transporter OS=Homo sapiens OX=9606 GN=SLC35A1 PE=1 SV=1
9	O08520	1.12e-86	268	336	0.371	0.438	S35A1_CRIGR CMP-sialic acid transporter OS=Cricetulus griseus OX=10029 GN=SLC35A1 PE=2 SV=1
10	Q61420	5.16e-85	264	336	0.371	0.438	S35A1_MOUSE CMP-sialic acid transporter OS=Mus musculus OX=10090 GN=Slc35a1 PE=1 SV=2
11	P87041	1.75e-82	258	353	0.374	0.419	GMS1_SCHPO UDP-galactose transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gms1 PE=2 SV=3
12	G5EFD3	9.27e-73	232	328	0.348	0.421	G5EFD3_CAEEL Nucleotide sugar transporter OS=Caenorhabditis elegans OX=6239 GN=srf-3 PE=2 SV=1
13	Q93890	1.26e-72	233	368	0.356	0.383	SRF3_CAEEL UDP-galactose/UDP-N-acetylglucosamine transporter srf-3 OS=Caenorhabditis elegans OX=6239 GN=srf-3 PE=1 SV=5
14	Q5K8Q8	3.22e-63	217	703	0.391	0.220	Q5K8Q8_CRYNJ Solute carrier family 35 (UDP-sugar transporter), member A1/2/3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CNL04830 PE=4 SV=2
15	G5EFB7	3.10e-58	192	244	0.275	0.447	G5EFB7_CAEEL UDP-galactose/UDP-N-acetylglucosamine transporter srf-3 OS=Caenorhabditis elegans OX=6239 GN=srf-3 PE=4 SV=1
16	Q02334	4.91e-55	187	355	0.283	0.315	UGTP1_CAEEL UDP-galactose translocator 1 OS=Caenorhabditis elegans OX=6239 GN=ugtp-1 PE=3 SV=2
17	Q5QHQ6	3.36e-38	146	561	0.263	0.185	Q5QHQ6_LEIMA LPG5B protein OS=Leishmania major OX=5664 GN=LPG5B PE=4 SV=1
18	F4JN00	1.14e-36	138	352	0.270	0.304	CSTR4_ARATH CMP-sialic acid transporter 4 OS=Arabidopsis thaliana OX=3702 GN=At4g35335 PE=2 SV=1
19	Q8LGE9	6.65e-33	128	340	0.205	0.238	CSTR1_ARATH CMP-sialic acid transporter 1 OS=Arabidopsis thaliana OX=3702 GN=At5g41760 PE=2 SV=1
20	Q654D9	8.65e-33	127	322	0.199	0.245	CSTR1_ORYSJ CMP-sialic acid transporter 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSTLP1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00892 EamA	0.063	24.9	EamA-like transporter family
2	PF04142 Nuc_sug_transp	1.5e-130	446.6	Nucleotide-sugar transporter
3	PF16913 PUNUT	1.8e+02	12.7	Purine nucleobase transmembrane transport
4	PF03151 TPT	78	14.1	Triose-phosphate Transporter family
5	PF07178 TraL	9e+02	11.6	TraL protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000037556

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000013822	0.785	NEDD4 binding protein 1
2	9598.ENSPTRP00000027708	0.695	UDP-glucuronosyltransferase
3	9598.ENSPTRP00000045445	0.694	Pan troglodytes cytochrome P450, family 3, subfamily A, polypeptide 67 (CYP3A7), mRNA
4	9598.ENSPTRP00000053490	0.694	UDP-glucuronosyltransferase
5	9598.ENSPTRP00000028795	0.693	UDP-glucuronosyltransferase
6	9598.ENSPTRP00000040241	0.692	UDP-glucuronosyltransferase
7	9598.ENSPTRP00000021554	0.691	Peptidylprolyl isomerase G (Cyclophilin G)
8	9598.ENSPTRP00000047158	0.675	UDP-glucuronosyltransferase
9	9598.ENSPTRP00000027702	0.668	UDP-glucuronosyltransferase
10	9598.ENSPTRP00000028145	0.666	Uncharacterized protein
11	9598.ENSPTRP00000016406	0.654	Uncharacterized protein
12	9598.ENSPTRP00000022339	0.642	Uncharacterized protein
13	9598.ENSPTRP00000041277	0.642	UDP-glucuronosyltransferase
14	9598.ENSPTRP00000053491	0.630	UDP-glucuronosyltransferase
15	9598.ENSPTRP00000060646	0.630	Uncharacterized protein
16	9598.ENSPTRP00000031329	0.611	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase
17	9598.ENSPTRP00000004853	0.587	Uncharacterized protein
18	9598.ENSPTRP00000006138	0.582	Solute carrier family 35, member C1
19	9598.ENSPTRP00000015932	0.573	Solute carrier family 35, member B1
20	9598.ENSPTRP00000011429	0.565	Polymerase that creates the 3'-poly(A) tail of mRNA's.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005459	1.000	UDP-galactose transmembrane transporter activity
GO:0005488	0.619	binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0055085	0.980	transmembrane transport
GO:1901264	0.978	carbohydrate derivative transport
GO:0015931	0.978	nucleobase-containing compound transport
GO:0015780	0.973	nucleotide-sugar transmembrane transport
GO:0015711	0.966	organic anion transport
GO:0071704	0.940	organic substance metabolic process
GO:0044238	0.938	primary metabolic process
GO:0044281	0.448	small molecule metabolic process
GO:0090481	0.380	pyrimidine nucleotide-sugar transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	0.998	organelle membrane
GO:0005794	0.998	Golgi apparatus
GO:0000139	0.993	Golgi membrane
GO:0070013	0.905	intracellular organelle lumen
GO:0005634	0.900	nucleus
GO:0005654	0.885	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]