StarFunc result for job id P78386

User Input

>input (507 residues)
MSCRSYRISSGCGVTRNFSSCSAVAPKTGNRCCISAAPYRGVSCYRGLTGFGSRSLCNLG
SCGPRIAVGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVK
QEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKWQFYQNQRCCESNLEPLFSGYIETLR
REAECVEADSGRLASELNHVQEVLEGYKKKYEEEVALRATAENEFVVLKKDVDCAYLRKS
DLEANVEALVEESSFLRRLYEEEIRVLQAHISDTSVIVKMDNSRDLNMDCIIAEIKAQYD
DVASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEIENAKCQR
AKLEAAVAEAEQQGEAALSDARCKLAELEGALQKAKQDMACLLKEYQEVMNSKLGLDIEI
ATYRRLLEGEEHRLCEGVGSVNVCVSSSRGGVSCGGLSYSTTPGRQITSGPSAIGGSITV
VAPDSCAPCQPRSSSFSCGSSRSVRFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78386	1.000	1.000	3.935E-66	507	1.000	1.000	P78386.pdb.gz	KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens OX=9606 GN=KRT85 PE=1 SV=1
2	AFDB:Q9NSB4	0.323	0.320	1.264E-33	513	0.611	0.604	Q9NSB4.pdb.gz	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
3	AFDB:Q99M73	0.436	0.383	7.836E-32	603	0.667	0.561	Q99M73.pdb.gz	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
4	AFDB:A0A1D5PXP0	0.382	0.373	9.831E-27	522	0.521	0.506	A0A1D5PXP0.pdb.gz
5	AFDB:Q8BGZ7	0.346	0.322	1.029E-25	551	0.535	0.492	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
6	AFDB:Q922U2	0.330	0.294	4.584E-25	580	0.517	0.452	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
7	AFDB:O95678	0.313	0.290	5.285E-25	551	0.527	0.485	O95678.pdb.gz	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
8	AFDB:P02538	0.328	0.299	6.542E-25	564	0.513	0.461	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
9	AFDB:Q9Z331	0.311	0.283	8.099E-25	562	0.505	0.456	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
10	AFDB:P19013	0.410	0.401	2.193E-24	520	0.475	0.463	P19013.pdb.gz	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KA07	0.0	728	543	0.710	0.663	A0A0G2KA07_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
2	A0A8I5ZLV7	0.0	742	487	0.750	0.780	A0A8I5ZLV7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
3	A0A8I6AFC7	0.0	745	488	0.755	0.785	A0A8I6AFC7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
4	A0A8I6G2U8	0.0	744	447	0.722	0.819	A0A8I6G2U8_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
5	A7M776	0.0	775	479	0.773	0.818	A7M776_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
6	O43790	0.0	803	486	0.805	0.840	KRT86_HUMAN Keratin, type II cuticular Hb6 OS=Homo sapiens OX=9606 GN=KRT86 PE=1 SV=1
7	P78385	0.0	791	493	0.805	0.828	KRT83_HUMAN Keratin, type II cuticular Hb3 OS=Homo sapiens OX=9606 GN=KRT83 PE=1 SV=2
8	P78386	0.0	1031	507	1.000	1.000	KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens OX=9606 GN=KRT85 PE=1 SV=1
9	Q14533	0.0	788	505	0.787	0.790	KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3
10	Q6IG08	0.0	749	555	0.730	0.667	Q6IG08_RAT Type II keratin Kb23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
11	Q99M73	0.0	617	603	0.651	0.547	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
12	Q9NSB2	0.0	592	600	0.629	0.532	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
13	Q9NSB4	0.0	562	513	0.602	0.595	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
14	O95678	1.60e-158	463	551	0.485	0.446	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
15	Q8BGZ7	6.87e-157	459	551	0.493	0.454	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
16	Q9DCV7	2.28e-155	452	457	0.469	0.521	K2C7_MOUSE Keratin, type II cytoskeletal 7 OS=Mus musculus OX=10090 GN=Krt7 PE=1 SV=1
17	P13647	3.19e-155	456	590	0.487	0.419	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
18	Q922U2	3.85e-154	453	580	0.430	0.376	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
19	P50446	2.50e-153	450	553	0.432	0.396	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
20	P05787	1.53e-152	446	483	0.430	0.451	K2C8_HUMAN Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15915 BAT	0.46	21.8	GAF and HTH_10 associated domain
2	PF07888 CALCOCO1	2.8	18.4	Calcium binding and coiled-coil domain (CALCOCO1) like
3	PF20270 CATRA-C	1.5e+02	14.4	CASPASE and TPR Repeat-Associated C-terminal domain
4	PF16271 DUF4924	4.4	18.8	Domain of unknown function (DUF4924)
5	PF05960 DUF885	9.1e+02	10.8	Bacterial protein of unknown function (DUF885)
6	PF00038 Filament	1.3e-96	335.5	Intermediate filament protein
7	PF16208 Keratin_2_head	1.6e-10	52.8	Keratin type II head
8	PF13801 Metal_resist	4e+02	12.6	Heavy-metal resistance
9	PF18595 Nuf2_DHR10-like	14	17.2	Nuf2, DHR10-like domain
10	PF18052 Rx_N	9.9e+02	11.4	Rx N-terminal domain
11	PF07926 TPR_MLP1_2	0.075	24.5	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257901

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000226247	0.571	Forkhead box protein N1
2	9606.ENSP00000257974	0.568	Keratin, type II cuticular Hb2
3	9606.ENSP00000267119	0.549	Keratin, type II cytoskeletal 71
4	9606.ENSP00000352785	0.545	Desmoglein-4
5	9606.ENSP00000307240	0.537	Keratin, type II cytoskeletal 74
6	9606.ENSP00000310861	0.530	Keratin, type II cytoskeletal 2 epidermal
7	9606.ENSP00000301656	0.528	Keratin, type I cytoskeletal 27
8	9606.ENSP00000378292	0.526	Keratin, type II cytoskeletal 80
9	9606.ENSP00000252245	0.524	Keratin, type II cytoskeletal 75
10	9606.ENSP00000307014	0.524	Keratin, type II cytoskeletal 73
11	9606.ENSP00000369317	0.524	Keratin, type II cytoskeletal 6A
12	9606.ENSP00000293745	0.523	Keratin, type II cytoskeletal 72
13	9606.ENSP00000306261	0.523	Keratin, type II cytoskeletal 78
14	9606.ENSP00000342710	0.523	Keratin, type II cytoskeletal 1b
15	9606.ENSP00000243056	0.518	Homeobox protein Hox-C13
16	9606.ENSP00000375151	0.518	Keratin-associated protein 4-3
17	9606.ENSP00000328358	0.517	Keratin, type II cytoskeletal 79
18	9606.ENSP00000330101	0.516	Keratin, type II cytoskeletal 2 oral
19	9606.ENSP00000329243	0.515	Keratin, type II cytoskeletal 7
20	9606.ENSP00000252244	0.514	Keratin, type II cytoskeletal 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.989	developmental process
GO:0009987	0.983	cellular process
GO:0048856	0.954	anatomical structure development
GO:0008544	0.857	epidermis development
GO:0032501	0.442	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0045111	0.996	intermediate filament cytoskeleton
GO:0099513	0.995	polymeric cytoskeletal fiber
GO:0045095	0.991	keratin filament
GO:0005615	0.986	extracellular space
GO:0070062	0.583	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]