StarFunc result for job id P78395

User Input

>input (509 residues)
MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAA
FDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
VLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVD
LFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEV
TCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQA
LYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVM
LTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
SALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMV
WLSANPCPHCGDRTFYDPEPILCPCFMPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1E6	0.952	0.952	1.565E-92	509	1.000	1.000	A0A024R1E6.pdb.gz
2	AFDB:P0DUQ2	0.858	0.912	1.251E-53	478	0.479	0.510	P0DUQ2.pdb.gz	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
3	AFDB:Q810Y8	0.821	0.869	5.658E-39	479	0.303	0.322	Q810Y8.pdb.gz	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
4	AFDB:E9Q5G7	0.770	0.788	3.711E-38	496	0.350	0.359	E9Q5G7.pdb.gz	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
5	AFDB:Q99MW3	0.701	0.775	5.406E-38	458	0.336	0.373	Q99MW3.pdb.gz	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
6	AFDB:Q15048	0.576	0.591	1.850E-31	493	0.287	0.296	Q15048.pdb.gz	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
7	AFDB:Q3UP24	0.403	0.229	4.864E-11	1024	0.157	0.078	Q3UP24.pdb.gz	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1
8	AFDB:Q9NPP4	0.390	0.223	3.366E-10	1024	0.155	0.077	Q9NPP4.pdb.gz	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
9	AFDB:Q8WX94	0.445	0.260	3.610E-8	980	0.171	0.089	Q8WX94.pdb.gz	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
10	AFDB:G3V6C0	0.302	0.166	6.519E-8	1153	0.116	0.051	G3V6C0.pdb.gz	G3V6C0_RAT Class II, major histocompatibility complex, transactivator OS=Rattus norvegicus OX=10116 GN=Ciita PE=4 SV=2
11	PDB:4kxfP	0.368	0.237	4.172E-7	866	0.171	0.100	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
12	PDB:3jblA	0.283	0.181	5.760E-7	909	0.145	0.081	3jblA.pdb.gz
13	PDB:3oglB	0.328	0.299	7.141E-7	568	0.124	0.111	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
14	PDB:1a4yA	0.379	0.413	1.040E-6	460	0.143	0.159	1a4yA.pdb.gz
15	PDB:7pzcA	0.396	0.217	4.206E-6	1010	0.138	0.069	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
16	PDB:7pmkL	0.369	0.389	4.942E-6	475	0.084	0.091	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
17	PDB:6hkwA	0.272	0.418	8.015E-6	306	0.084	0.141	6hkwA.pdb.gz
18	PDB:6o60C	0.306	0.376	1.106E-5	389	0.110	0.144	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
19	PDB:2p1nB	0.278	0.256	1.527E-5	571	0.112	0.100	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
20	PDB:7b5mT	0.279	0.406	4.474E-5	325	0.083	0.129	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78395	0.0	1038	509	1.000	1.000	PRAME_HUMAN Melanoma antigen preferentially expressed in tumors OS=Homo sapiens OX=9606 GN=PRAME PE=1 SV=1
2	P0DUQ2	9.32e-155	451	478	0.481	0.513	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
3	Q5VXH4	4.88e-153	447	476	0.483	0.517	PRAM6_HUMAN PRAME family member 6 OS=Homo sapiens OX=9606 GN=PRAMEF6 PE=1 SV=1
4	Q99MW3	9.43e-96	299	458	0.356	0.395	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
5	E9Q5G7	1.35e-77	253	496	0.354	0.363	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
6	Q810Y8	8.85e-77	251	479	0.306	0.326	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
7	Q15048	2.07e-50	181	493	0.293	0.302	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
8	P59047	2.30e-04	46.6	1200	0.069	0.029	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
9	Q647I9	4.78e-04	45.4	1098	0.075	0.035	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
10	F1MT67	5.87e-04	45.1	1098	0.075	0.035	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
11	Q8KC98	0.072	38.5	1102	0.079	0.036	Q8KC98_CHLTE Rab family protein OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1526 PE=1 SV=1
12	Q86W24	0.078	38.1	1093	0.067	0.031	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
13	J3KN39	0.13	37.7	1059	0.069	0.033	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
14	Q9NX02	0.13	37.4	1062	0.069	0.033	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
15	Q9R1M5	0.14	37.4	1163	0.069	0.030	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
16	Q9C000	0.17	37.4	1473	0.067	0.023	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
17	Q8K3Z0	0.87	35.0	1020	0.049	0.025	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1
18	Q80SY9	0.98	34.7	1013	0.049	0.025	Q80SY9_MOUSE NOD2 OS=Mus musculus OX=10090 GN=Nod2 PE=2 SV=1
19	Q98SP8	1.1	34.3	629	0.035	0.029	EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis OX=8355 GN=epabp-a PE=1 SV=2
20	Q57Z09	1.2	34.3	432	0.047	0.056	Q57Z09_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.750 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445675

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000444856	0.981	Cullin-2
2	9606.ENSP00000320147	0.926	Histone-lysine N-methyltransferase EZH2
3	9606.ENSP00000262306	0.905	Elongin-B
4	9606.ENSP00000478121	0.891	Elongin-C
5	9606.ENSP00000231572	0.823	Arginine--tRNA ligase, cytoplasmic
6	9606.ENSP00000473093	0.806	Melanoma-associated antigen 3
7	9606.ENSP00000220514	0.782	Protein Mis18-beta
8	9606.ENSP00000206542	0.781	Probable tRNA N6-adenosine threonylcarbamoyltransferase
9	9606.ENSP00000302855	0.779	Zinc finger protein 280A
10	9606.ENSP00000200457	0.766	Thyroid receptor-interacting protein 6
11	9606.ENSP00000480958	0.740	Zinc finger protein 280B
12	9606.ENSP00000349085	0.735	Melanoma-associated antigen 1
13	9606.ENSP00000374354	0.724	Exosome complex component RRP43
14	9606.ENSP00000332602	0.716	Cancer/testis antigen 1B
15	9606.ENSP00000469441	0.710	Cancer/testis antigen 1A
16	9606.ENSP00000331327	0.702	Wilms tumor protein
17	9606.ENSP00000476960	0.699	Histone cluster 2 H3 pseudogene 2
18	9606.ENSP00000353379	0.696	Melanoma-associated antigen 4
19	9606.ENSP00000338796	0.681	Synovial sarcoma, X breakpoint 2
20	9606.ENSP00000485185	0.670	Unknown. Candidate gene encoding tumor antigens

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990756	1.000	ubiquitin ligase-substrate adaptor activity
GO:0005515	0.999	protein binding
GO:0140297	0.782	DNA-binding transcription factor binding
GO:0016922	0.762	nuclear receptor binding
GO:0042974	0.754	nuclear retinoic acid receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.978	primary metabolic process
GO:0050789	0.976	regulation of biological process
GO:0006807	0.972	nitrogen compound metabolic process
GO:0050794	0.972	regulation of cellular process
GO:0044237	0.958	cellular metabolic process
GO:0043170	0.947	macromolecule metabolic process
GO:1901564	0.946	organonitrogen compound metabolic process
GO:1901575	0.945	organic substance catabolic process
GO:0009057	0.944	macromolecule catabolic process
GO:0019538	0.942	protein metabolic process
GO:0044260	0.940	cellular macromolecule metabolic process
GO:0044265	0.929	cellular macromolecule catabolic process
GO:0030163	0.928	protein catabolic process
GO:0006511	0.918	ubiquitin-dependent protein catabolic process
GO:0010498	0.900	proteasomal protein catabolic process
GO:0043161	0.859	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0019222	0.793	regulation of metabolic process
GO:0060255	0.724	regulation of macromolecule metabolic process
GO:0051171	0.617	regulation of nitrogen compound metabolic process
GO:0080090	0.616	regulation of primary metabolic process
GO:0048519	0.612	negative regulation of biological process
GO:0031323	0.600	regulation of cellular metabolic process
GO:0009892	0.597	negative regulation of metabolic process
GO:0048523	0.595	negative regulation of cellular process
GO:0031326	0.592	regulation of cellular biosynthetic process
GO:0010556	0.591	regulation of macromolecule biosynthetic process
GO:0010468	0.590	regulation of gene expression
GO:0051252	0.588	regulation of RNA metabolic process
GO:0048518	0.568	positive regulation of biological process
GO:0048522	0.532	positive regulation of cellular process
GO:0010605	0.523	negative regulation of macromolecule metabolic process
GO:0031324	0.436	negative regulation of cellular metabolic process
GO:0031327	0.432	negative regulation of cellular biosynthetic process
GO:0045934	0.432	negative regulation of nucleobase-containing compound metabolic process
GO:0006355	0.429	regulation of DNA-templated transcription
GO:0010558	0.428	negative regulation of macromolecule biosynthetic process
GO:0051253	0.411	negative regulation of RNA metabolic process
GO:0048583	0.398	regulation of response to stimulus
GO:0043412	0.388	macromolecule modification
GO:0045892	0.329	negative regulation of DNA-templated transcription
GO:0070647	0.313	protein modification by small protein conjugation or removal
GO:0009968	0.312	negative regulation of signal transduction
GO:0010941	0.307	regulation of cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0016020	0.997	membrane
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005886	0.991	plasma membrane
GO:1902494	0.988	catalytic complex
GO:0005829	0.936	cytosol
GO:0140535	0.854	intracellular protein-containing complex
GO:1990234	0.836	transferase complex
GO:0000151	0.771	ubiquitin ligase complex
GO:0031461	0.757	cullin-RING ubiquitin ligase complex
GO:0031462	0.698	Cul2-RING ubiquitin ligase complex
GO:0005694	0.603	chromosome
GO:0000785	0.460	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]