StarFunc result for job id P78413

User Input

>input (519 residues)
MSYPQFGYPYSSAPQFLMATNSLSTCCESGGRTLADSGPAASAQAPVYCPVYESRLLATA
RHELNSAAALGVYGGPYGGSQGYGNYVTYGSEASAFYSLNSFDSKDGSGSAHGGLAPAAA
AYYPYEPALGQYPYDRYGTMDSGTRRKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAI
ITKMTLTQVSTWFANARRRLKKENKMTWPPRNKCADEKRPYAEGEEEEGGEEEAREEPLK
SSKNAEPVGKEEKELELSDLDDFDPLEAEPPACELKPPFHSLDGGLERVPAAPDGPVKEA
SGALRMSLAAGGGAALDEDLERARSCLRSAAAGPEPLPGAEGGPQVCEAKLGFVPAGASA
GLEAKPRIWSLAHTATAAAAAATSLSQTEFPSCMLKRQGPAAPAAVSSAPATSPSVALPH
SGALDRHQDSPVTSLRNWVDGVFHDPILRHSTLNQAWATAKGALLDPGPLGRSLGAGANV
LTAPLARAFPPAVPQDAPAAGAARELLALPKAGGKPFCA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78413	0.999	0.999	1.452E-75	519	1.000	1.000	P78413.pdb.gz	IRX4_HUMAN Iroquois-class homeodomain protein IRX-4 OS=Homo sapiens OX=9606 GN=IRX4 PE=1 SV=2
2	AFDB:Q90XW6	0.240	0.249	6.182E-42	496	0.617	0.645	Q90XW6.pdb.gz	IRX4A_XENLA Iroquois-class homeodomain protein irx-4-A OS=Xenopus laevis OX=8355 GN=irx4-a PE=2 SV=1
3	AFDB:Q6NZU4	0.189	0.221	5.057E-34	440	0.532	0.627	Q6NZU4.pdb.gz	Q6NZU4_DANRE Iroquois homeobox 4a OS=Danio rerio OX=7955 GN=zgc:77362 PE=2 SV=1
4	AFDB:P78414	0.144	0.156	3.265E-14	480	0.318	0.344	P78414.pdb.gz	IRX1_HUMAN Iroquois-class homeodomain protein IRX-1 OS=Homo sapiens OX=9606 GN=IRX1 PE=2 SV=3
5	AFDB:P48785	0.116	0.080	2.540E-4	796	0.137	0.089	P48785.pdb.gz	PRH_ARATH Pathogenesis-related homeodomain protein OS=Arabidopsis thaliana OX=3702 GN=PRH PE=2 SV=1
6	AFDB:Q8VIH1	0.114	0.112	4.275E-4	527	0.177	0.175	Q8VIH1.pdb.gz	NOBOX_MOUSE Homeobox protein NOBOX OS=Mus musculus OX=10090 GN=Nobox PE=1 SV=1
7	AFDB:Q54VB4	0.067	0.058	8.746E-4	639	0.106	0.086	Q54VB4.pdb.gz	HBX9_DICDI Homeobox protein 9 OS=Dictyostelium discoideum OX=44689 GN=hbx9 PE=3 SV=1
8	AFDB:A6NJT0	0.115	0.113	2.175E-3	531	0.185	0.181	A6NJT0.pdb.gz	UNC4_HUMAN Homeobox protein unc-4 homolog OS=Homo sapiens OX=9606 GN=UNCX PE=3 SV=1
9	PDB:4egcA	0.097	0.093	3.405E-3	539	0.040	0.039	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
10	AFDB:Q8CBC4	0.081	0.065	3.134E-2	711	0.166	0.121	Q8CBC4.pdb.gz	CNST_MOUSE Consortin OS=Mus musculus OX=10090 GN=Cnst PE=1 SV=1
11	AFDB:Q8NFH8	0.073	0.061	3.809E-2	660	0.137	0.108	Q8NFH8.pdb.gz	REPS2_HUMAN RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens OX=9606 GN=REPS2 PE=1 SV=2
12	PDB:2hi3A	0.119	0.650	2.339E-1	73	0.023	0.164	2hi3A.pdb.gz
13	PDB:5nr5A	0.093	0.369	1.758	113	0.021	0.097	5nr5A.pdb.gz
14	PDB:7fbyA	0.079	0.227	2.598	153	0.027	0.092	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:2vbwA	0.074	0.204	2.773	147	0.017	0.061	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
16	PDB:3bdnA	0.054	0.100	2.773	234	0.027	0.060	3bdnA.pdb.gz	Crystal structure of the lambda repressor and a model for pairwise cooperative operator binding
17	PDB:6gejS	0.044	0.089	3.158	208	0.027	0.067	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
18	PDB:3femA	0.066	0.118	3.839	281	0.010	0.018	3femA.pdb.gz
19	PDB:5b49B	0.065	0.121	3.839	247	0.013	0.028	5b49B.pdb.gz	Crystal structures of the UDP-diacylglucosamine pyrophosphohydrase LpxH from Pseudomonas aeruginosa
20	PDB:6dv9F	0.063	0.151	4.097	174	0.023	0.069	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZRI4	0.0	785	515	0.811	0.817	D3ZRI4_RAT Iroquois homeobox 4 OS=Rattus norvegicus OX=10116 GN=Irx4 PE=3 SV=1
2	P78413	0.0	1045	519	1.000	1.000	IRX4_HUMAN Iroquois-class homeodomain protein IRX-4 OS=Homo sapiens OX=9606 GN=IRX4 PE=1 SV=2
3	Q90XW6	0.0	592	496	0.624	0.653	IRX4A_XENLA Iroquois-class homeodomain protein irx-4-A OS=Xenopus laevis OX=8355 GN=irx4-a PE=2 SV=1
4	Q9QY61	0.0	803	515	0.827	0.833	IRX4_MOUSE Iroquois-class homeodomain protein IRX-4 OS=Mus musculus OX=10090 GN=Irx4 PE=2 SV=1
5	Q6NZU4	3.53e-178	510	440	0.565	0.666	Q6NZU4_DANRE Iroquois homeobox 4a OS=Danio rerio OX=7955 GN=zgc:77362 PE=2 SV=1
6	Q9ER75	4.04e-78	253	438	0.272	0.322	IRX6_MOUSE Iroquois-class homeodomain protein IRX-6 OS=Mus musculus OX=10090 GN=Irx6 PE=2 SV=2
7	P78412	5.89e-76	248	446	0.277	0.323	IRX6_HUMAN Iroquois-class homeodomain protein IRX-6 OS=Homo sapiens OX=9606 GN=IRX6 PE=1 SV=3
8	Q90Z68	2.59e-52	186	454	0.268	0.306	Q90Z68_DANRE Iroquois 3 homeobox protein OS=Danio rerio OX=7955 GN=hm:zehn0543 PE=2 SV=1
9	Q24248	8.99e-47	175	717	0.227	0.165	ARA_DROME Homeobox protein araucan OS=Drosophila melanogaster OX=7227 GN=ara PE=1 SV=2
10	Q6NY58	4.99e-46	166	343	0.202	0.306	Q6NY58_DANRE Iroquois homeobox 3b OS=Danio rerio OX=7955 GN=ziro3b PE=2 SV=1
11	O42261	1.11e-44	165	448	0.233	0.270	IRX3_XENLA Iroquois-class homeodomain protein irx-3 OS=Xenopus laevis OX=8355 GN=irx3 PE=2 SV=2
12	M9PI45	1.42e-43	166	682	0.179	0.136	M9PI45_DROME Mirror, isoform C OS=Drosophila melanogaster OX=7227 GN=mirr PE=3 SV=1
13	O01667	1.44e-43	165	641	0.179	0.145	O01667_DROME Homeoprotein Sail OS=Drosophila melanogaster OX=7227 GN=mirr PE=2 SV=1
14	Q9VU01	1.59e-43	165	641	0.179	0.145	Q9VU01_DROME Mirror, isoform A OS=Drosophila melanogaster OX=7227 GN=mirr PE=3 SV=1
15	P78411	3.81e-43	162	483	0.208	0.224	IRX5_HUMAN Iroquois-class homeodomain protein IRX-5 OS=Homo sapiens OX=9606 GN=IRX5 PE=1 SV=3
16	Q9JKQ4	5.30e-43	161	484	0.258	0.277	IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 OS=Mus musculus OX=10090 GN=Irx5 PE=2 SV=1
17	Q1LXU5	6.44e-43	160	446	0.268	0.312	IRX5A_DANRE Iroquois homeobox protein 5a OS=Danio rerio OX=7955 GN=irx5a PE=2 SV=1
18	P81068	3.45e-42	159	480	0.229	0.248	IRX1_MOUSE Iroquois-class homeodomain protein IRX-1 OS=Mus musculus OX=10090 GN=Irx1 PE=1 SV=4
19	Q90YN0	5.07e-42	157	445	0.291	0.339	Q90YN0_DANRE Iroquois homeobox protein Ziro1 OS=Danio rerio OX=7955 GN=ziro1 PE=2 SV=1
20	P54269	7.99e-42	161	693	0.220	0.165	CAUP_DROME Homeobox protein caupolican OS=Drosophila melanogaster OX=7227 GN=caup PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	8.4e-12	56.1	Homeobox KN domain
2	PF00046 Homeodomain	0.00069	30.7	Homeodomain
3	PF10210 MRP-S32	1.8e+02	14.1	Mitochondrial 28S ribosomal protein S32

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003808019.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003822884.1	0.708	T-box transcription factor TBX18
2	9597.XP_003833053.1	0.636	One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
3	9597.XP_003832473.1	0.621	T-box 3
4	9597.XP_003814051.1	0.590	Homeobox protein Nkx-2.5 isoform X1
5	9597.XP_008975069.1	0.562	A-kinase anchoring protein 11
6	9597.XP_003832516.1	0.553	Myosin light chain 2
7	9597.XP_003832474.1	0.552	T-box transcription factor TBX5 isoform X1
8	9597.XP_003824309.1	0.519	Distal-less homeobox 2
9	9597.XP_008973840.1	0.519	Natriuretic peptides A
10	9597.XP_003827384.1	0.507	Family with sequence similarity 69 member C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.992	nucleic acid binding
GO:0003677	0.983	DNA binding
GO:0043565	0.964	sequence-specific DNA binding
GO:0003700	0.932	DNA-binding transcription factor activity
GO:1990837	0.930	sequence-specific double-stranded DNA binding
GO:0000981	0.843	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.563	transcription cis-regulatory region binding
GO:0001228	0.430	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.998	multicellular organismal process
GO:0048856	0.996	anatomical structure development
GO:0007275	0.994	multicellular organism development
GO:0048731	0.961	system development
GO:0048513	0.942	animal organ development
GO:0050794	0.825	regulation of cellular process
GO:0007507	0.791	heart development
GO:0019222	0.582	regulation of metabolic process
GO:0080090	0.563	regulation of primary metabolic process
GO:0051171	0.563	regulation of nitrogen compound metabolic process
GO:0031323	0.563	regulation of cellular metabolic process
GO:0060255	0.545	regulation of macromolecule metabolic process
GO:0019219	0.542	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.540	cellular process
GO:0010468	0.522	regulation of gene expression
GO:2001141	0.517	regulation of RNA biosynthetic process
GO:0006355	0.508	regulation of DNA-templated transcription
GO:0009653	0.456	anatomical structure morphogenesis
GO:0006357	0.302	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0031981	0.981	nuclear lumen
GO:0005654	0.953	nucleoplasm
GO:0005737	0.688	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]