StarFunc result for job id P78414

User Input

>input (480 residues)
MSFPQLGYPQYLSAAGPGAYGGERPGVLAAAAAAAAAASSGRPGAAELGGGAGAAAVTSV
LGMYAAAGPYAGAPNYSAFLPYAADLSLFSQMGSQYELKDNPGVHPATFAAHTAPAYYPY
GQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFAN
ARRRLKKENKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQ
SNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDSPLGLAKEAPEPGSTRLLSPG
AAAGGLQGAPHGKPKIWSLAETATSPDGAPKASPPPPAGHPGAHGPSAGAPLQHPAFLPS
HGLYTCHIGKFSNWTNSAFLAQGSLLNMRSFLGVGAPHAAPHGPHLPAPPPPQPPVAIAP
GALNGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78414	0.999	0.999	1.770E-66	480	1.000	1.000	P78414.pdb.gz	IRX1_HUMAN Iroquois-class homeodomain protein IRX-1 OS=Homo sapiens OX=9606 GN=IRX1 PE=2 SV=3
2	AFDB:Q9YGK8	0.347	0.354	2.342E-43	467	0.683	0.702	Q9YGK8.pdb.gz	IRX1A_XENLA Iroquois-class homeodomain protein irx-1-A OS=Xenopus laevis OX=8355 GN=irx1-a PE=2 SV=1
3	AFDB:Q90XW6	0.134	0.130	2.227E-14	496	0.302	0.292	Q90XW6.pdb.gz	IRX4A_XENLA Iroquois-class homeodomain protein irx-4-A OS=Xenopus laevis OX=8355 GN=irx4-a PE=2 SV=1
4	AFDB:P78413	0.149	0.139	3.947E-14	519	0.356	0.329	P78413.pdb.gz	IRX4_HUMAN Iroquois-class homeodomain protein IRX-4 OS=Homo sapiens OX=9606 GN=IRX4 PE=1 SV=2
5	AFDB:P81066	0.145	0.147	6.161E-14	474	0.340	0.344	P81066.pdb.gz	IRX2_MOUSE Iroquois-class homeodomain protein IRX-2 OS=Mus musculus OX=10090 GN=Irx2 PE=2 SV=2
6	AFDB:Q9JKQ4	0.149	0.148	1.240E-13	484	0.321	0.318	Q9JKQ4.pdb.gz	IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 OS=Mus musculus OX=10090 GN=Irx5 PE=2 SV=1
7	AFDB:Q6DCQ1	0.166	0.173	3.897E-13	455	0.312	0.330	Q6DCQ1.pdb.gz	IRX2_XENLA Iroquois-class homeodomain protein irx-2 OS=Xenopus laevis OX=8355 GN=irx2 PE=2 SV=1
8	AFDB:Q8VIH1	0.114	0.104	5.426E-4	527	0.165	0.150	Q8VIH1.pdb.gz	NOBOX_MOUSE Homeobox protein NOBOX OS=Mus musculus OX=10090 GN=Nobox PE=1 SV=1
9	AFDB:Q90XD1	0.087	0.086	6.484E-3	485	0.181	0.179	Q90XD1.pdb.gz	Q90XD1_DANRE HMG-box transcription factor Sox10 OS=Danio rerio OX=7955 GN=cls/sox10 PE=2 SV=1
10	PDB:4egcA	0.099	0.089	7.667E-3	539	0.044	0.039	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
11	AFDB:Q57XD0	0.074	0.067	2.037E-2	545	0.185	0.163	Q57XD0.pdb.gz	Q57XD0_TRYB2 LYT1p OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.580 PE=4 SV=1
12	PDB:2hi3A	0.126	0.615	2.261E-2	73	0.029	0.192	2hi3A.pdb.gz
13	PDB:2vbwA	0.090	0.247	9.046E-1	147	0.025	0.082	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
14	PDB:5nr5A	0.107	0.381	1.027	113	0.035	0.150	5nr5A.pdb.gz
15	PDB:6n7pA	0.046	0.099	1.243	186	0.056	0.145	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
16	PDB:7fbyA	0.091	0.231	2.204	153	0.019	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
17	PDB:2rvqD	0.076	0.208	2.503	129	0.037	0.140	2rvqD.pdb.gz
18	PDB:1c0wB	0.076	0.145	2.667	219	0.017	0.037	1c0wB.pdb.gz	Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
19	PDB:6zheC	0.058	0.042	2.667	705	0.035	0.024	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
20	PDB:2cg4A	0.090	0.233	2.842	149	0.021	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78414	0.0	953	480	1.000	1.000	IRX1_HUMAN Iroquois-class homeodomain protein IRX-1 OS=Homo sapiens OX=9606 GN=IRX1 PE=2 SV=3
2	P81068	0.0	769	480	0.915	0.915	IRX1_MOUSE Iroquois-class homeodomain protein IRX-1 OS=Mus musculus OX=10090 GN=Irx1 PE=1 SV=4
3	Q9YGK8	0.0	569	467	0.683	0.702	IRX1A_XENLA Iroquois-class homeodomain protein irx-1-A OS=Xenopus laevis OX=8355 GN=irx1-a PE=2 SV=1
4	Q90XQ7	1.64e-165	476	426	0.613	0.690	Q90XQ7_DANRE Iroquois homeobox protein Ziro1 OS=Danio rerio OX=7955 GN=ziro1 PE=2 SV=1
5	Q8JH33	1.30e-152	442	419	0.546	0.625	Q8JH33_DANRE Iroquois homeobox protein ziro1-a OS=Danio rerio OX=7955 GN=ziro1 PE=2 SV=1
6	Q90YN0	8.10e-127	378	445	0.490	0.528	Q90YN0_DANRE Iroquois homeobox protein Ziro1 OS=Danio rerio OX=7955 GN=ziro1 PE=2 SV=1
7	Q90Z68	2.04e-97	303	454	0.425	0.449	Q90Z68_DANRE Iroquois 3 homeobox protein OS=Danio rerio OX=7955 GN=hm:zehn0543 PE=2 SV=1
8	Q6NY58	1.63e-82	260	343	0.338	0.472	Q6NY58_DANRE Iroquois homeobox 3b OS=Danio rerio OX=7955 GN=ziro3b PE=2 SV=1
9	O42261	5.31e-81	260	448	0.394	0.422	IRX3_XENLA Iroquois-class homeodomain protein irx-3 OS=Xenopus laevis OX=8355 GN=irx3 PE=2 SV=2
10	P81067	7.86e-66	222	507	0.265	0.250	IRX3_MOUSE Iroquois-class homeodomain protein IRX-3 OS=Mus musculus OX=10090 GN=Irx3 PE=1 SV=2
11	P78415	1.50e-62	213	501	0.260	0.250	IRX3_HUMAN Iroquois-class homeodomain protein IRX-3 OS=Homo sapiens OX=9606 GN=IRX3 PE=2 SV=3
12	Q6NZU4	1.75e-52	185	440	0.290	0.316	Q6NZU4_DANRE Iroquois homeobox 4a OS=Danio rerio OX=7955 GN=zgc:77362 PE=2 SV=1
13	Q9ER75	6.80e-52	183	438	0.333	0.365	IRX6_MOUSE Iroquois-class homeodomain protein IRX-6 OS=Mus musculus OX=10090 GN=Irx6 PE=2 SV=2
14	Q90XW6	4.22e-47	172	496	0.302	0.292	IRX4A_XENLA Iroquois-class homeodomain protein irx-4-A OS=Xenopus laevis OX=8355 GN=irx4-a PE=2 SV=1
15	P78412	1.93e-46	169	446	0.246	0.265	IRX6_HUMAN Iroquois-class homeodomain protein IRX-6 OS=Homo sapiens OX=9606 GN=IRX6 PE=1 SV=3
16	Q1LXU5	4.07e-46	168	446	0.269	0.289	IRX5A_DANRE Iroquois homeobox protein 5a OS=Danio rerio OX=7955 GN=irx5a PE=2 SV=1
17	Q6DCQ1	4.05e-45	166	455	0.306	0.323	IRX2_XENLA Iroquois-class homeodomain protein irx-2 OS=Xenopus laevis OX=8355 GN=irx2 PE=2 SV=1
18	D3ZRI4	4.89e-45	166	515	0.335	0.313	D3ZRI4_RAT Iroquois homeobox 4 OS=Rattus norvegicus OX=10116 GN=Irx4 PE=3 SV=1
19	Q9JKQ4	7.79e-45	165	484	0.277	0.275	IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 OS=Mus musculus OX=10090 GN=Irx5 PE=2 SV=1
20	Q9QY61	3.63e-44	164	515	0.331	0.309	IRX4_MOUSE Iroquois-class homeodomain protein IRX-4 OS=Mus musculus OX=10090 GN=Irx4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05086 Dicty_REP	6.8e+02	9.6	Dictyostelium (Slime Mold) REP protein
2	PF05920 Homeobox_KN	5.7e-12	56.7	Homeobox KN domain
3	PF00046 Homeodomain	0.0029	28.7	Homeodomain
4	PF10210 MRP-S32	1.6e+02	14.3	Mitochondrial 28S ribosomal protein S32

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305244

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364946	0.846	Homeobox protein Mohawk
2	9606.ENSP00000290552	0.833	Iroquois-class homeodomain protein IRX-6
3	9606.ENSP00000393453	0.733	Histone-lysine N-methyltransferase SMYD1
4	9606.ENSP00000333496	0.720	Potassium voltage-gated channel subfamily D member 2
5	9606.ENSP00000354478	0.652	Homeobox protein DLX-1
6	9606.ENSP00000418823	0.650	Alpha-ketoglutarate-dependent dioxygenase FTO
7	9606.ENSP00000402257	0.648	Protein CBFA2T1
8	9606.ENSP00000025301	0.641	A-kinase anchor protein 11
9	9606.ENSP00000234198	0.620	Homeobox protein DLX-2
10	9606.ENSP00000281830	0.609	Potassium voltage-gated channel subfamily E member 4
11	9606.ENSP00000282541	0.605	Glycerol-3-phosphate dehydrogenase 1-like protein
12	9606.ENSP00000369251	0.600	Putative nucleotidyltransferase MAB21L1
13	9606.ENSP00000482245	0.598	Dachshund homolog 1
14	9606.ENSP00000323584	0.593	Teashirt homolog 1
15	9606.ENSP00000365514	0.538	Zinc finger protein ZIC 2
16	9606.ENSP00000310557	0.537	Potassium voltage-gated channel subfamily E member 3
17	9606.ENSP00000320025	0.537	Voltage-dependent L-type calcium channel subunit beta-2
18	9606.ENSP00000352565	0.535	Heart- and neural crest derivatives-expressed protein 2
19	9606.ENSP00000279873	0.530	AT-rich interactive domain-containing protein 5B
20	9606.ENSP00000369257	0.527	Protein fantom

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0001227	0.998	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0005515	0.952	protein binding
GO:0000976	0.639	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.981	multicellular organismal process
GO:0050794	0.975	regulation of cellular process
GO:0032502	0.968	developmental process
GO:0080090	0.955	regulation of primary metabolic process
GO:0051171	0.955	regulation of nitrogen compound metabolic process
GO:0031323	0.955	regulation of cellular metabolic process
GO:0009889	0.954	regulation of biosynthetic process
GO:0048856	0.953	anatomical structure development
GO:0051252	0.951	regulation of RNA metabolic process
GO:0007275	0.940	multicellular organism development
GO:0010468	0.934	regulation of gene expression
GO:1903506	0.929	regulation of nucleic acid-templated transcription
GO:0006355	0.920	regulation of DNA-templated transcription
GO:0048519	0.912	negative regulation of biological process
GO:0048731	0.872	system development
GO:0048523	0.836	negative regulation of cellular process
GO:0009892	0.831	negative regulation of metabolic process
GO:0048513	0.813	animal organ development
GO:0009890	0.785	negative regulation of biosynthetic process
GO:0045934	0.782	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.780	negative regulation of macromolecule metabolic process
GO:0000122	0.767	negative regulation of transcription by RNA polymerase II
GO:0009987	0.708	cellular process
GO:0009653	0.682	anatomical structure morphogenesis
GO:0009790	0.487	embryo development
GO:0009887	0.472	animal organ morphogenesis
GO:0048518	0.450	positive regulation of biological process
GO:0007399	0.396	nervous system development
GO:0048522	0.379	positive regulation of cellular process
GO:0010604	0.321	positive regulation of macromolecule metabolic process
GO:0045935	0.312	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.304	positive regulation of RNA metabolic process
GO:0010557	0.302	positive regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.985	membrane-enclosed lumen
GO:0005654	0.976	nucleoplasm
GO:0005737	0.350	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]