StarFunc result for job id P78417

User Input

>input (241 residues)
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYG
L

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78417	1.000	1.000	2.165E-40	241	1.000	1.000	P78417.pdb.gz	GSTO1_HUMAN Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1 PE=1 SV=2
2	PDB:6mhcA	0.983	0.971	1.218E-36	244	1.000	0.988	6mhcA.pdb.gz	Structure-Based Design of N-(5-Phenylthiazol-2-yl)acrylamides as Novel and Potent Glutathione S-Transferase Omega 1 Inhibitors.
3	AFDB:Q9Z339	0.995	0.995	1.160E-34	241	0.780	0.780	Q9Z339.pdb.gz	GSTO1_RAT Glutathione S-transferase omega-1 OS=Rattus norvegicus OX=10116 GN=Gsto1 PE=1 SV=2
4	AFDB:Q9H4Y5	0.976	0.968	3.873E-31	243	0.643	0.638	Q9H4Y5.pdb.gz	GSTO2_HUMAN Glutathione S-transferase omega-2 OS=Homo sapiens OX=9606 GN=GSTO2 PE=1 SV=1
5	PDB:3qagA	0.952	0.964	8.157E-29	238	0.651	0.660	3qagA.pdb.gz	Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.
6	AFDB:C1BFM5	0.947	0.955	1.722E-26	239	0.568	0.573	C1BFM5.pdb.gz	C1BFM5_ONCMY Glutathione S-transferase omega OS=Oncorhynchus mykiss OX=8022 GN=GSTO1 PE=2 SV=1
7	AFDB:F1QBZ6	0.948	0.952	5.686E-26	240	0.560	0.562	F1QBZ6.pdb.gz
8	AFDB:O45352	0.909	0.864	8.137E-19	254	0.407	0.386	O45352.pdb.gz	O45352_CAEEL Glutathione S-transferase omega OS=Caenorhabditis elegans OX=6239 GN=gst-44 PE=3 SV=2
9	AFDB:Q9VSL3	0.835	0.828	9.929E-19	243	0.402	0.399	Q9VSL3.pdb.gz	SEPIA_DROME Pyrimidodiazepine synthase OS=Drosophila melanogaster OX=7227 GN=se PE=1 SV=1
10	AFDB:Q9VSL5	0.887	0.854	2.687E-18	251	0.324	0.311	Q9VSL5.pdb.gz	Q9VSL5_DROME Glutathione S transferase O2, isoform A OS=Drosophila melanogaster OX=7227 GN=GstO2 PE=1 SV=2
11	AFDB:Q9VSL2	0.853	0.853	5.959E-18	241	0.361	0.361	Q9VSL2.pdb.gz	Q9VSL2_DROME Glutathione S transferase O3 OS=Drosophila melanogaster OX=7227 GN=GstO3 PE=1 SV=1
12	AFDB:Q7K206	0.877	0.795	8.033E-18	267	0.336	0.303	Q7K206.pdb.gz	Q7K206_DROME LD27185p (Fragment) OS=Drosophila melanogaster OX=7227 GN=GstO2 PE=2 SV=1
13	PDB:4agsA	0.766	0.429	1.079E-11	445	0.224	0.121	4agsA.pdb.gz	Leishmania Tdr1 Structure, a Unique Trimeric Glutathione Transferase Capable of Deglutathionylation and Antimonial Prodrug Activation.
14	PDB:5o84A	0.758	0.839	1.253E-11	216	0.207	0.231	5o84A.pdb.gz
15	PDB:5g5aA	0.788	0.862	4.138E-11	219	0.241	0.265	5g5aA.pdb.gz	Structure of Glutathione Transferase U25 from Arabidopsis Thaliana
16	PDB:5echB	0.769	0.859	5.050E-11	214	0.228	0.257	5echB.pdb.gz	Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
17	PDB:5d9vA	0.629	0.708	1.066E-10	211	0.203	0.232	5d9vA.pdb.gz	Structural understanding of the recycling of oxidized ascorbate by dehydroascorbate reductase (OsDHAR) from Oryza sativa L. japonica
18	PDB:2v6kA	0.656	0.730	8.621E-10	214	0.183	0.206	2v6kA.pdb.gz	Structure of Bacterial Glutathione-S-Transferase Maleyl Pyruvate Isomerase and Implications for Mechanism of Isomerisation.
19	PDB:2cz2A	0.694	0.781	9.523E-10	212	0.216	0.245	2cz2A.pdb.gz	Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from Mus musculus (form-1 crystal)
20	PDB:5el8A	0.664	0.743	1.162E-9	213	0.203	0.230	5el8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78417	0.0	496	241	1.000	1.000	GSTO1_HUMAN Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1 PE=1 SV=2
2	Q9Z339	8.06e-147	411	241	0.780	0.780	GSTO1_RAT Glutathione S-transferase omega-1 OS=Rattus norvegicus OX=10116 GN=Gsto1 PE=1 SV=2
3	Q9H4Y5	5.02e-116	333	243	0.643	0.638	GSTO2_HUMAN Glutathione S-transferase omega-2 OS=Homo sapiens OX=9606 GN=GSTO2 PE=1 SV=1
4	Q5U3M8	6.03e-95	280	240	0.560	0.562	Q5U3M8_DANRE Glutathione S-transferase omega OS=Danio rerio OX=7955 GN=zgc:101897 PE=1 SV=1
5	C1BFM5	2.47e-94	278	239	0.564	0.569	C1BFM5_ONCMY Glutathione S-transferase omega OS=Oncorhynchus mykiss OX=8022 GN=GSTO1 PE=2 SV=1
6	C1BFQ9	1.85e-92	273	237	0.564	0.574	C1BFQ9_ONCMY Glutathione S-transferase omega OS=Oncorhynchus mykiss OX=8022 GN=GSTO1 PE=2 SV=1
7	C1BG28	1.56e-91	271	237	0.560	0.570	C1BG28_ONCMY Glutathione S-transferase omega OS=Oncorhynchus mykiss OX=8022 GN=GSTO1 PE=2 SV=1
8	C1BHF6	3.65e-91	270	237	0.560	0.570	C1BHF6_ONCMY Glutathione S-transferase omega OS=Oncorhynchus mykiss OX=8022 GN=GSTO1 PE=2 SV=1
9	Q9VSL3	1.51e-51	169	243	0.390	0.387	SEPIA_DROME Pyrimidodiazepine synthase OS=Drosophila melanogaster OX=7227 GN=se PE=1 SV=1
10	Q9VSL2	7.63e-46	154	241	0.373	0.373	Q9VSL2_DROME Glutathione S transferase O3 OS=Drosophila melanogaster OX=7227 GN=GstO3 PE=1 SV=1
11	O45352	3.69e-44	150	254	0.411	0.390	O45352_CAEEL Glutathione S-transferase omega OS=Caenorhabditis elegans OX=6239 GN=gst-44 PE=3 SV=2
12	Q9VSL4	2.45e-42	146	250	0.357	0.344	Q9VSL4_DROME Glutathione S transferase O2, isoform B OS=Drosophila melanogaster OX=7227 GN=GstO2 PE=1 SV=2
13	Q7K206	5.12e-42	145	267	0.357	0.322	Q7K206_DROME LD27185p (Fragment) OS=Drosophila melanogaster OX=7227 GN=GstO2 PE=2 SV=1
14	P34345	1.80e-39	138	250	0.349	0.336	GSTO1_CAEEL Glutathione transferase omega-1 OS=Caenorhabditis elegans OX=6239 GN=gsto-1 PE=1 SV=1
15	Q9VSL5	9.32e-38	134	251	0.299	0.287	Q9VSL5_DROME Glutathione S transferase O2, isoform A OS=Drosophila melanogaster OX=7227 GN=GstO2 PE=1 SV=2
16	Q9VSL6	2.54e-36	130	254	0.340	0.323	Q9VSL6_DROME Glutathione S transferase O1 OS=Drosophila melanogaster OX=7227 GN=GstO1 PE=1 SV=1
17	Q9ZP61	2.16e-15	74.7	222	0.232	0.252	Q9ZP61_MAIZE Glutathione S-transferase OS=Zea mays OX=4577 GN=gst6 PE=2 SV=1
18	P46421	3.02e-15	74.3	224	0.216	0.232	GSTU5_ARATH Glutathione S-transferase U5 OS=Arabidopsis thaliana OX=3702 GN=GSTU5 PE=2 SV=1
19	Q9C8M3	5.12e-15	73.6	224	0.278	0.299	GSTUS_ARATH Glutathione S-transferase U28 OS=Arabidopsis thaliana OX=3702 GN=GSTU28 PE=3 SV=1
20	Q65XA0	8.45e-15	72.8	213	0.195	0.221	DHAR1_ORYSJ Probable glutathione S-transferase DHAR1, cytosolic OS=Oryza sativa subsp. japonica OX=39947 GN=DHAR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00462 Glutaredoxin	6.4	18.4	Glutaredoxin
2	PF00043 GST_C	0.00033	32.1	Glutathione S-transferase, C-terminal domain
3	PF13410 GST_C_2	0.0044	28.3	Glutathione S-transferase, C-terminal domain
4	PF14497 GST_C_3	7.5e-06	37.4	Glutathione S-transferase, C-terminal domain
5	PF16865 GST_C_5	4.4e+02	12.9	Glutathione S-transferase, C-terminal domain
6	PF02798 GST_N	3.1e-11	54.8	Glutathione S-transferase, N-terminal domain
7	PF13409 GST_N_2	4.2e-13	60.8	Glutathione S-transferase, N-terminal domain
8	PF13417 GST_N_3	6.8e-16	69.6	Glutathione S-transferase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381607	0.932	Glutathione S-transferase P
2	9606.ENSP00000290765	0.906	Glutathione S-transferase theta-2B
3	9606.ENSP00000216951	0.905	Glutathione synthetase
4	9606.ENSP00000360002	0.905	Glutathione S-transferase A4
5	9606.ENSP00000295256	0.903	Hematopoietic prostaglandin D synthase
6	9606.ENSP00000376134	0.900	Signal transducer and activator of transcription 4
7	9606.ENSP00000311469	0.896	Glutathione S-transferase Mu 1
8	9606.ENSP00000256594	0.888	Glutathione S-transferase Mu 3
9	9606.ENSP00000335620	0.879	Glutathione S-transferase A1
10	9606.ENSP00000241337	0.878	Glutathione S-transferase Mu 2
11	9606.ENSP00000346103	0.877	Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
12	9606.ENSP00000342026	0.853	Peroxiredoxin-6
13	9606.ENSP00000211122	0.852	Glutathione S-transferase A3
14	9606.ENSP00000420168	0.852	Glutathione S-transferase A2
15	9606.ENSP00000256593	0.847	Glutathione S-transferase Mu 5
16	9606.ENSP00000356864	0.847	Microsomal glutathione S-transferase 3
17	9606.ENSP00000480004	0.836	Epoxide hydrolase 1
18	9606.ENSP00000221130	0.829	Glutathione reductase, mitochondrial
19	9606.ENSP00000379512	0.824	Microsomal glutathione S-transferase 1
20	9606.ENSP00000373477	0.816	Glutathione peroxidase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016209	1.000	antioxidant activity
GO:0015036	1.000	disulfide oxidoreductase activity
GO:0004364	1.000	glutathione transferase activity
GO:0005488	0.995	binding
GO:0016672	0.989	oxidoreductase activity, acting on a sulfur group of donors, quinone or similar compound as acceptor
GO:0015038	0.989	glutathione disulfide oxidoreductase activity
GO:0005515	0.984	protein binding
GO:0043167	0.473	ion binding
GO:0045174	0.429	glutathione dehydrogenase (ascorbate) activity
GO:0042802	0.304	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:1901334	0.993	lactone metabolic process
GO:0044238	0.991	primary metabolic process
GO:0044281	0.976	small molecule metabolic process
GO:0006766	0.963	vitamin metabolic process
GO:0006767	0.950	water-soluble vitamin metabolic process
GO:0050896	0.928	response to stimulus
GO:0006082	0.896	organic acid metabolic process
GO:0043436	0.894	oxoacid metabolic process
GO:0019752	0.827	carboxylic acid metabolic process
GO:0042221	0.821	response to chemical
GO:0005996	0.573	monosaccharide metabolic process
GO:0051716	0.480	cellular response to stimulus
GO:0070887	0.454	cellular response to chemical stimulus
GO:0006805	0.428	xenobiotic metabolic process
GO:0065007	0.412	biological regulation
GO:0050789	0.344	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	1.000	cytosol
GO:0005576	0.986	extracellular region
GO:0031982	0.968	vesicle
GO:0005615	0.957	extracellular space
GO:0070062	0.950	extracellular exosome
GO:0043231	0.832	intracellular membrane-bounded organelle
GO:0016020	0.369	membrane
GO:0071944	0.368	cell periphery
GO:0005886	0.305	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	1.000	Acting on a sulfur group of donors.
EC:2.5.1.18	1.000	glutathione transferase.
EC:1.8.5.-	0.989	With a quinone or similar compound as acceptor.
RHEA:24424	0.429	2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate
EC:1.8.5.1	0.429	glutathione dehydrogenase (ascorbate).

[back to server]