StarFunc result for job id P78423

User Input

>input (397 residues)
MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGK
RAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGG
MDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP
VGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENA
PSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMF
TYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78423	1.000	1.000	2.535E-57	397	1.000	1.000	P78423.pdb.gz	X3CL1_HUMAN Fractalkine OS=Homo sapiens OX=9606 GN=CX3CL1 PE=1 SV=1
2	AFDB:O35188	0.267	0.268	1.557E-34	395	0.645	0.648	O35188.pdb.gz	X3CL1_MOUSE Fractalkine OS=Mus musculus OX=10090 GN=Cx3cl1 PE=1 SV=3
3	PDB:1esrA	0.172	0.808	2.820E-6	76	0.068	0.355	1esrA.pdb.gz
4	PDB:1bo0A	0.149	0.699	8.183E-6	76	0.060	0.316	1bo0A.pdb.gz
5	PDB:4zltF	0.149	0.905	1.068E-5	62	0.043	0.274	4zltF.pdb.gz
6	PDB:2mp1A	0.152	0.655	3.100E-5	77	0.043	0.221	2mp1A.pdb.gz
7	PDB:2ra4B	0.140	0.823	3.313E-5	65	0.050	0.308	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
8	PDB:7f1qR	0.159	0.171	3.313E-5	367	0.048	0.052	7f1qR.pdb.gz
9	PDB:1nr4E	0.149	0.760	4.046E-5	69	0.050	0.290	1nr4E.pdb.gz
10	PDB:7f1tA	0.136	0.128	4.046E-5	423	0.050	0.047	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
11	PDB:1j8iA	0.145	0.551	6.448E-5	93	0.065	0.280	1j8iA.pdb.gz
12	PDB:4mheA	0.129	0.658	7.874E-5	69	0.045	0.261	4mheA.pdb.gz
13	AFDB:P26051	0.108	0.092	2.631E-1	503	0.134	0.105	P26051.pdb.gz	CD44_RAT CD44 antigen OS=Rattus norvegicus OX=10116 GN=Cd44 PE=1 SV=2
14	AFDB:Q9Z2D7	0.079	0.061	8.162E-1	554	0.139	0.099	Q9Z2D7.pdb.gz	MBD4_MOUSE Methyl-CpG-binding domain protein 4 OS=Mus musculus OX=10090 GN=Mbd4 PE=1 SV=1
15	AFDB:A1Z898	0.067	0.041	9.324E-1	747	0.139	0.074	A1Z898.pdb.gz	A1Z898_DROME Chromatin assembly factor 1, p105 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-105 PE=1 SV=1
16	AFDB:D4A9W8	0.082	0.062	9.324E-1	566	0.111	0.078	D4A9W8.pdb.gz	D4A9W8_RAT Methyl-CpG-binding domain protein 4 OS=Rattus norvegicus OX=10116 GN=Mbd4 PE=4 SV=4
17	AFDB:Q8BGD7	0.096	0.057	9.324E-1	802	0.179	0.089	Q8BGD7.pdb.gz	NPAS4_MOUSE Neuronal PAS domain-containing protein 4 OS=Mus musculus OX=10090 GN=Npas4 PE=1 SV=1
18	AFDB:O95243	0.094	0.066	1.139	580	0.123	0.084	O95243.pdb.gz	MBD4_HUMAN Methyl-CpG-binding domain protein 4 OS=Homo sapiens OX=9606 GN=MBD4 PE=1 SV=1
19	AFDB:Q3UMU9	0.129	0.088	1.139	669	0.149	0.088	Q3UMU9.pdb.gz	HDGR2_MOUSE Hepatoma-derived growth factor-related protein 2 OS=Mus musculus OX=10090 GN=Hdgfl2 PE=1 SV=1
20	AFDB:Q66HD3	0.068	0.046	1.301	776	0.169	0.086	Q66HD3.pdb.gz	NASP_RAT Nuclear autoantigenic sperm protein OS=Rattus norvegicus OX=10116 GN=Nasp PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78423	0.0	806	397	1.000	1.000	X3CL1_HUMAN Fractalkine OS=Homo sapiens OX=9606 GN=CX3CL1 PE=1 SV=1
2	O55145	4.29e-164	467	393	0.685	0.692	X3CL1_RAT Fractalkine OS=Rattus norvegicus OX=10116 GN=Cx3cl1 PE=2 SV=3
3	O35188	4.23e-157	449	395	0.657	0.661	X3CL1_MOUSE Fractalkine OS=Mus musculus OX=10090 GN=Cx3cl1 PE=1 SV=3
4	P80075	5.12e-08	52.8	99	0.065	0.263	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
5	P48298	2.54e-07	50.4	97	0.068	0.278	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
6	Q9ERE0	5.23e-07	49.7	93	0.055	0.237	CCL17_RAT C-C motif chemokine 17 OS=Rattus norvegicus OX=10116 GN=Ccl17 PE=3 SV=1
7	P97545	7.56e-07	49.3	97	0.065	0.268	CCL11_RAT Eotaxin OS=Rattus norvegicus OX=10116 GN=Ccl11 PE=3 SV=1
8	Q99616	9.59e-07	48.9	98	0.055	0.224	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
9	A0A2R8QR67	1.87e-06	48.1	102	0.058	0.225	A0A2R8QR67_DANRE C-C motif chemokine 21-like OS=Danio rerio OX=7955 GN=ccl25a PE=4 SV=1
10	E9PTY9	2.11e-06	48.1	103	0.053	0.204	E9PTY9_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl17 PE=3 SV=2
11	P80098	2.70e-06	47.8	99	0.060	0.242	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
12	P13500	2.76e-06	47.8	99	0.060	0.242	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
13	D4ABS1	3.21e-06	47.4	98	0.068	0.276	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
14	P10148	3.28e-06	48.9	148	0.060	0.162	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
15	Q62401	2.32e-05	45.1	104	0.065	0.250	CCL12_MOUSE C-C motif chemokine 12 OS=Mus musculus OX=10090 GN=Ccl12 PE=2 SV=1
16	O00175	2.43e-05	45.4	119	0.045	0.151	CCL24_HUMAN C-C motif chemokine 24 OS=Homo sapiens OX=9606 GN=CCL24 PE=1 SV=2
17	Q9Z121	3.70e-05	44.3	97	0.058	0.237	CCL8_MOUSE C-C motif chemokine 8 OS=Mus musculus OX=10090 GN=Ccl8 PE=3 SV=1
18	P50229	5.02e-05	43.9	92	0.045	0.196	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
19	P51671	5.41e-05	43.9	97	0.050	0.206	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
20	P10855	5.87e-05	43.9	92	0.048	0.207	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	4.2e-08	44.6	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000006053

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351059	0.999	CX3C chemokine receptor 1
2	9606.ENSP00000292301	0.945	C-C chemokine receptor type 2
3	9606.ENSP00000295683	0.945	C-X-C chemokine receptor type 1
4	9606.ENSP00000386884	0.934	C-X-C chemokine receptor type 4
5	9606.ENSP00000296140	0.899	C-C chemokine receptor type 1
6	9606.ENSP00000362795	0.886	C-X-C chemokine receptor type 3
7	9606.ENSP00000319635	0.870	C-X-C chemokine receptor type 2
8	9606.ENSP00000292303	0.862	C-C chemokine receptor type 5
9	9606.ENSP00000420298	0.839	OX-2 membrane glycoprotein
10	9606.ENSP00000225831	0.837	C-C motif chemokine 2
11	9606.ENSP00000441600	0.826	C-C chemokine receptor type 3
12	9606.ENSP00000246657	0.804	C-C chemokine receptor type 7
13	9606.ENSP00000395704	0.791	C-X-C chemokine receptor type 6
14	9606.ENSP00000474412	0.779	C-C motif chemokine 5
15	9606.ENSP00000326432	0.768	C-C chemokine receptor type 8
16	9606.ENSP00000343952	0.768	Chemokine (C-C motif) receptor 6
17	9606.ENSP00000292174	0.756	C-X-C chemokine receptor type 5
18	9606.ENSP00000350256	0.751	C-C chemokine receptor type 9
19	9606.ENSP00000379110	0.747	Growth-regulated alpha protein
20	9606.ENSP00000310405	0.746	Chemokine XC receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0044877	0.918	protein-containing complex binding
GO:0005178	0.901	integrin binding
GO:0042056	0.891	chemoattractant activity
GO:0031737	0.875	CX3C chemokine receptor binding
GO:0045236	0.641	CXCR chemokine receptor binding
GO:0045237	0.631	CXCR1 chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0002376	0.992	immune system process
GO:0007154	0.991	cell communication
GO:0023052	0.990	signaling
GO:0030335	0.990	positive regulation of cell migration
GO:0006952	0.989	defense response
GO:0032101	0.988	regulation of response to external stimulus
GO:0065008	0.985	regulation of biological quality
GO:0051716	0.985	cellular response to stimulus
GO:0042221	0.983	response to chemical
GO:0009966	0.983	regulation of signal transduction
GO:0002684	0.982	positive regulation of immune system process
GO:0007165	0.982	signal transduction
GO:0009605	0.976	response to external stimulus
GO:0001775	0.976	cell activation
GO:0051241	0.975	negative regulation of multicellular organismal process
GO:0001817	0.973	regulation of cytokine production
GO:0006935	0.972	chemotaxis
GO:0048523	0.971	negative regulation of cellular process
GO:0032103	0.971	positive regulation of response to external stimulus
GO:0002685	0.971	regulation of leukocyte migration
GO:0007166	0.970	cell surface receptor signaling pathway
GO:0010941	0.969	regulation of cell death
GO:0032502	0.967	developmental process
GO:0009892	0.965	negative regulation of metabolic process
GO:0051128	0.963	regulation of cellular component organization
GO:0010604	0.957	positive regulation of macromolecule metabolic process
GO:1902533	0.957	positive regulation of intracellular signal transduction
GO:0010605	0.950	negative regulation of macromolecule metabolic process
GO:0070887	0.948	cellular response to chemical stimulus
GO:0042127	0.944	regulation of cell population proliferation
GO:0006954	0.942	inflammatory response
GO:0060548	0.942	negative regulation of cell death
GO:0030595	0.942	leukocyte chemotaxis
GO:0032879	0.941	regulation of localization
GO:0080134	0.938	regulation of response to stress
GO:0048856	0.937	anatomical structure development
GO:0009968	0.937	negative regulation of signal transduction
GO:0043408	0.934	regulation of MAPK cascade
GO:0050793	0.933	regulation of developmental process
GO:0071345	0.932	cellular response to cytokine stimulus
GO:0043066	0.928	negative regulation of apoptotic process
GO:0002687	0.926	positive regulation of leukocyte migration
GO:0080090	0.917	regulation of primary metabolic process
GO:0007267	0.917	cell-cell signaling
GO:0010629	0.913	negative regulation of gene expression
GO:0051171	0.912	regulation of nitrogen compound metabolic process
GO:0031347	0.912	regulation of defense response
GO:0008284	0.911	positive regulation of cell population proliferation
GO:0006955	0.909	immune response
GO:0031323	0.906	regulation of cellular metabolic process
GO:0043410	0.900	positive regulation of MAPK cascade
GO:0044093	0.899	positive regulation of molecular function
GO:0071674	0.899	mononuclear cell migration
GO:0050727	0.896	regulation of inflammatory response
GO:0032652	0.893	regulation of interleukin-1 production
GO:1905521	0.890	regulation of macrophage migration
GO:0051173	0.888	positive regulation of nitrogen compound metabolic process
GO:0031325	0.888	positive regulation of cellular metabolic process
GO:0007275	0.878	multicellular organism development
GO:0051896	0.873	regulation of protein kinase B signaling
GO:2000026	0.871	regulation of multicellular organismal development
GO:0001818	0.865	negative regulation of cytokine production
GO:0051049	0.862	regulation of transport
GO:2001236	0.859	regulation of extrinsic apoptotic signaling pathway
GO:0051897	0.847	positive regulation of protein kinase B signaling
GO:0051246	0.844	regulation of protein metabolic process
GO:0072676	0.817	lymphocyte migration
GO:0048731	0.813	system development
GO:0050920	0.801	regulation of chemotaxis
GO:1901214	0.797	regulation of neuron death
GO:0051247	0.775	positive regulation of protein metabolic process
GO:0030154	0.773	cell differentiation
GO:2001234	0.768	negative regulation of apoptotic signaling pathway
GO:0010628	0.757	positive regulation of gene expression
GO:0019220	0.751	regulation of phosphate metabolic process
GO:0032692	0.749	negative regulation of interleukin-1 production
GO:0030155	0.743	regulation of cell adhesion
GO:0051050	0.737	positive regulation of transport
GO:0042327	0.721	positive regulation of phosphorylation
GO:0009889	0.720	regulation of biosynthetic process
GO:0051240	0.716	positive regulation of multicellular organismal process
GO:0001932	0.695	regulation of protein phosphorylation
GO:0045321	0.655	leukocyte activation
GO:0019221	0.653	cytokine-mediated signaling pathway
GO:0010556	0.634	regulation of macromolecule biosynthetic process
GO:0031326	0.626	regulation of cellular biosynthetic process
GO:0051130	0.621	positive regulation of cellular component organization
GO:0006355	0.615	regulation of DNA-templated transcription
GO:0071840	0.586	cellular component organization or biogenesis
GO:0016043	0.556	cellular component organization
GO:0051924	0.551	regulation of calcium ion transport
GO:0051928	0.534	positive regulation of calcium ion transport
GO:0007155	0.523	cell adhesion
GO:0045595	0.479	regulation of cell differentiation
GO:0045785	0.422	positive regulation of cell adhesion
GO:0050921	0.397	positive regulation of chemotaxis
GO:0060284	0.390	regulation of cell development
GO:0002688	0.378	regulation of leukocyte chemotaxis
GO:0097529	0.352	myeloid leukocyte migration
GO:0044419	0.318	biological process involved in interspecies interaction between organisms
GO:0043207	0.316	response to external biotic stimulus
GO:0051707	0.312	response to other organism
GO:0007399	0.310	nervous system development
GO:0048468	0.300	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005886	0.999	plasma membrane
GO:0005622	0.937	intracellular anatomical structure
GO:0005737	0.934	cytoplasm
GO:0009986	0.928	cell surface
GO:0043227	0.737	membrane-bounded organelle
GO:0043229	0.709	intracellular organelle
GO:0005615	0.583	extracellular space
GO:0120025	0.523	plasma membrane bounded cell projection
GO:0043231	0.501	intracellular membrane-bounded organelle
GO:0043233	0.426	organelle lumen
GO:0070013	0.424	intracellular organelle lumen
GO:0012505	0.338	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]