StarFunc result for job id P78424

User Input

>input (691 residues)
MSALLQDPMIAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPS
KLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQPLLTAQQLASAVAGVMPGGPPALNQP
ILIPFNMAGQLGGQQGLVLTLPTANLTNIQGLVAAAAAGGIMTLPLQNLQATSSLNSQLQ
QLQLQLQQQQQQQQQQPPPSTNQHPQPAPQAPSQSQQQPLQPTPPQQPPPASQQPPAPTS
QLQQAPQPQQHQPHSHSQNQNQPSPTQQSSSPPQKPSQSPGHGLPSPLTPPNPLQLVNNP
LASQAAAAAAAMSSIASSQAFGNALSSLQGVTGQLVTNAQGQIIGTIPLMPNPGPSSQAA
SGTQGLQVQPITPQLLTNAQGQIIATVIGNQILPVINTQGITLSPIKPGQQLHQPSQTSV
GQAASQGNLLHLAHSQASMSQSPVRQASSSSSSSSSSSALSVGQLVSNPQTAAGEVDGVN
LEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQE
NTIASSLTAKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFI
GSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQ
ALKNTIKRLKQHEPATAVPLEPLTDSLEENS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78424	1.000	1.000	2.734E-93	691	1.000	1.000	P78424.pdb.gz	PO6F2_HUMAN POU domain, class 6, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU6F2 PE=1 SV=3
2	AFDB:A0A0R4J6S2	0.431	0.429	1.366E-62	694	0.734	0.731	A0A0R4J6S2.pdb.gz	A0A0R4J6S2_DANRE POU domain protein OS=Danio rerio OX=7955 GN=pou6f2 PE=3 SV=1
3	AFDB:P31367	0.252	0.283	3.511E-30	610	0.370	0.420	P31367.pdb.gz	PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio OX=7955 GN=pou6f1 PE=2 SV=1
4	AFDB:Q9NJB5	0.098	0.068	3.992E-6	1081	0.158	0.101	Q9NJB5.pdb.gz	ONEC_DROME Homeobox protein onecut OS=Drosophila melanogaster OX=7227 GN=onecut PE=2 SV=2
5	AFDB:Q54I36	0.066	0.041	1.311E-3	1338	0.156	0.081	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
6	AFDB:Q57W46	0.059	0.035	5.579E-3	1315	0.151	0.079	Q57W46.pdb.gz	Q57W46_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.310 PE=4 SV=1
7	AFDB:P10105	0.091	0.098	6.265E-3	635	0.149	0.162	P10105.pdb.gz	LAB_DROME Homeotic protein labial OS=Drosophila melanogaster OX=7227 GN=lab PE=1 SV=2
8	PDB:6t90K	0.095	0.824	9.142E-3	73	0.038	0.356	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
9	AFDB:P34278	0.061	0.045	2.517E-2	1010	0.132	0.090	P34278.pdb.gz	KNL1_CAEEL Kinetochore null protein 1 OS=Caenorhabditis elegans OX=6239 GN=knl-1 PE=1 SV=3
10	AFDB:A0A0C4DG68	0.066	0.055	4.760E-2	876	0.169	0.134	A0A0C4DG68.pdb.gz	A0A0C4DG68_HUMAN Pumilio RNA binding family member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PUM2 PE=1 SV=1
11	AFDB:P39769	0.047	0.029	4.760E-2	1589	0.187	0.081	P39769.pdb.gz	PHP_DROME Polyhomeotic-proximal chromatin protein OS=Drosophila melanogaster OX=7227 GN=ph-p PE=1 SV=2
12	PDB:2hi3A	0.076	0.540	1.971E-1	73	0.027	0.260	2hi3A.pdb.gz
13	PDB:4egcA	0.074	0.091	1.971E-1	539	0.030	0.039	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
14	PDB:7ml4M	0.054	0.127	3.728E-1	234	0.035	0.103	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
15	PDB:1oqyA	0.036	0.060	4.700E-1	363	0.058	0.110	1oqyA.pdb.gz
16	PDB:3g33B	0.065	0.154	6.279E-1	229	0.038	0.114	3g33B.pdb.gz
17	PDB:2w96A	0.076	0.161	9.420E-1	249	0.033	0.092	2w96A.pdb.gz
18	PDB:6icnA	0.053	0.101	1.413	344	0.014	0.029	6icnA.pdb.gz	Structural and Mechanistic Insights into Caffeine Degradation by the Bacterial N-Demethylase Complex.
19	PDB:7fbyA	0.062	0.229	1.413	153	0.016	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
20	PDB:5mrca	0.075	0.214	1.782	177	0.014	0.056	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4J6S2	0.0	630	694	0.517	0.514	A0A0R4J6S2_DANRE POU domain protein OS=Danio rerio OX=7955 GN=pou6f2 PE=3 SV=1
2	P78424	0.0	1350	691	1.000	1.000	PO6F2_HUMAN POU domain, class 6, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU6F2 PE=1 SV=3
3	P31367	1.21e-102	328	610	0.279	0.316	PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio OX=7955 GN=pou6f1 PE=2 SV=1
4	Q07916	9.95e-102	315	301	0.259	0.595	PO6F1_MOUSE POU domain, class 6, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou6f1 PE=1 SV=1
5	Q14863	1.68e-101	314	301	0.263	0.605	PO6F1_HUMAN POU domain, class 6, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
6	Q5U4D4	9.69e-101	322	576	0.263	0.316	Q5U4D4_MOUSE POU domain protein OS=Mus musculus OX=10090 GN=Pou6f1 PE=1 SV=1
7	A0A1C7CYY7	2.61e-100	321	577	0.268	0.321	A0A1C7CYY7_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
8	A0A1C7CYV8	2.89e-100	322	611	0.268	0.303	A0A1C7CYV8_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
9	P56223	5.23e-100	310	301	0.258	0.591	PO6F1_RAT POU domain, class 6, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou6f1 PE=2 SV=1
10	Q7JUR9	6.42e-77	268	994	0.187	0.130	Q7JUR9_DROME AT16994p OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=2 SV=1
11	A0A0B4JD55	2.18e-76	269	1292	0.181	0.097	A0A0B4JD55_DROME Pou domain motif 3, isoform F OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=4 SV=1
12	B7YZU0	3.51e-76	268	1291	0.185	0.099	B7YZU0_DROME Pou domain motif 3, isoform C OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=4 SV=2
13	A0A0B4LEG2	7.58e-76	267	1273	0.181	0.098	A0A0B4LEG2_DROME POU domain protein OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=3 SV=1
14	Q91989	4.13e-32	131	426	0.109	0.176	P5F13_XENLA POU domain, class 5, transcription factor 1.3 OS=Xenopus laevis OX=8355 GN=pou5f1.3 PE=1 SV=1
15	Q00286	6.01e-32	127	291	0.103	0.244	PIT1_MOUSE Pituitary-specific positive transcription factor 1 OS=Mus musculus OX=10090 GN=Pou1f1 PE=1 SV=1
16	P10037	7.43e-32	127	291	0.103	0.244	PIT1_RAT Pituitary-specific positive transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou1f1 PE=1 SV=3
17	P28069	2.11e-31	126	291	0.103	0.244	PIT1_HUMAN Pituitary-specific positive transcription factor 1 OS=Homo sapiens OX=9606 GN=POU1F1 PE=1 SV=1
18	Q6TGI4	2.72e-29	121	350	0.098	0.194	Q6TGI4_DANRE POU domain protein OS=Danio rerio OX=7955 GN=pit1 PE=2 SV=1
19	A7Y7W2	4.38e-29	122	389	0.101	0.180	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
20	Q7T103	1.31e-28	121	449	0.103	0.158	P5F11_XENLA POU domain, class 5, transcription factor 1.1 OS=Xenopus laevis OX=8355 GN=pou5f1.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18075 FtsX_ECD	18	17.3	FtsX extracellular domain
2	PF17943 HOCHOB	34	16.6	Homeobox-cysteine loop-homeobox
3	PF05920 Homeobox_KN	24	16.2	Homeobox KN domain
4	PF00046 Homeodomain	1.2e-14	65.2	Homeodomain
5	PF00157 Pou	5.1e-22	88.9	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384004

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000455507	0.765	Obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
2	9606.ENSP00000329117	0.732	APC membrane recruitment protein 1
3	9606.ENSP00000384264	0.708	cGMP-gated cation channel alpha-1
4	9606.ENSP00000385158	0.684	Protein FAM161A
5	9606.ENSP00000411593	0.668	Glycine receptor subunit alpha-1
6	9606.ENSP00000311816	0.661	RE1-silencing transcription factor
7	9606.ENSP00000468348	0.649	Dual specificity mitogen-activated protein kinase kinase 6
8	9606.ENSP00000361177	0.590	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1
9	9606.ENSP00000297157	0.578	Retinitis pigmentosa 9 protein
10	9606.ENSP00000344285	0.566	Brain-specific homeobox protein homolog
11	9606.ENSP00000357844	0.558	Monocarboxylate transporter 10
12	9606.ENSP00000331327	0.550	Wilms tumor protein
13	9606.ENSP00000324693	0.540	Grainyhead-like protein 1 homolog
14	9606.ENSP00000360811	0.515	LIM/homeobox protein Lhx3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0043565	0.995	sequence-specific DNA binding
GO:1990837	0.735	sequence-specific double-stranded DNA binding
GO:0000981	0.550	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.329	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:2001141	0.984	regulation of RNA biosynthetic process
GO:1903506	0.974	regulation of nucleic acid-templated transcription
GO:0032501	0.964	multicellular organismal process
GO:0010468	0.953	regulation of gene expression
GO:0006355	0.940	regulation of DNA-templated transcription
GO:0009987	0.934	cellular process
GO:0032502	0.864	developmental process
GO:0050953	0.798	sensory perception of light stimulus
GO:0048856	0.752	anatomical structure development
GO:0007275	0.428	multicellular organism development
GO:0048518	0.369	positive regulation of biological process
GO:0048731	0.362	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.983	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]