StarFunc result for job id P78426

User Input

>input (367 residues)
MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSSSSSSSSSSSP
SPPLGTHNPGGLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASP
SGSSSSSSSSASASSASAAAAAAAAAAAAASSPAGLLAGLPRFSSLSPPPPPPGLYFSPS
AAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTR
PTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMA
TAKKKQDSETERLKGASENEEEDDDYNKPLDPNSDDEKITQLLKKHKSSSGGGGGLLLHA
SEPESSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78426	0.999	0.999	9.115E-51	367	1.000	1.000	P78426.pdb.gz	NKX61_HUMAN Homeobox protein Nkx-6.1 OS=Homo sapiens OX=9606 GN=NKX6-1 PE=1 SV=2
2	AFDB:F1QUC3	0.394	0.453	3.702E-33	312	0.689	0.811	F1QUC3.pdb.gz
3	AFDB:Q9NY43	0.197	0.187	1.124E-6	387	0.210	0.199	Q9NY43.pdb.gz	BARH2_HUMAN BarH-like 2 homeobox protein OS=Homo sapiens OX=9606 GN=BARHL2 PE=1 SV=2
4	AFDB:P82976	0.156	0.142	3.143E-5	418	0.251	0.220	P82976.pdb.gz	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
5	AFDB:Q9YH70	0.169	0.185	4.061E-5	334	0.147	0.162	Q9YH70.pdb.gz	Q9YH70_XENLA VENT homeobox 2, gene 2 S homeolog OS=Xenopus laevis OX=8355 GN=ventx2.2.S PE=4 SV=1
6	AFDB:P79724	0.164	0.205	9.957E-5	289	0.158	0.201	P79724.pdb.gz	HXADB_DANRE Homeobox protein Hox-A13b OS=Danio rerio OX=7955 GN=hoxa13b PE=2 SV=3
7	AFDB:P09085	0.190	0.166	1.132E-4	427	0.191	0.164	P09085.pdb.gz	CAD_DROME Homeotic protein caudal OS=Drosophila melanogaster OX=7227 GN=cad PE=1 SV=4
8	AFDB:B2RYB5	0.179	0.210	1.372E-4	313	0.163	0.192	B2RYB5.pdb.gz	B2RYB5_RAT Hoxa10 protein OS=Rattus norvegicus OX=10116 GN=Hoxa10 PE=2 SV=1
9	AFDB:P31275	0.183	0.234	1.462E-4	282	0.169	0.220	P31275.pdb.gz	HXC12_HUMAN Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2
10	AFDB:Q6W990	0.184	0.216	1.772E-4	310	0.166	0.197	Q6W990.pdb.gz	HXADA_DANRE Homeobox protein Hox-A13a OS=Danio rerio OX=7955 GN=hoxa13a PE=3 SV=2
11	PDB:4egcA	0.138	0.094	7.144E-3	539	0.044	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.136	0.616	2.924E-2	73	0.041	0.205	2hi3A.pdb.gz
13	PDB:5nr5A	0.111	0.315	2.270E-1	113	0.033	0.106	5nr5A.pdb.gz
14	PDB:7fbyA	0.106	0.231	5.934E-1	153	0.022	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:5aj0BZ	0.115	0.410	1.280	86	0.027	0.116	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
16	PDB:2cg4A	0.110	0.252	1.365	149	0.016	0.040	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:7awtE	0.089	0.196	1.365	156	0.025	0.058	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
18	PDB:5mrca	0.093	0.171	1.455	177	0.057	0.119	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:4ldzA	0.136	0.243	2.589	196	0.033	0.061	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
20	PDB:5fywR	0.100	0.177	2.760	199	0.027	0.050	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35762	0.0	683	365	0.965	0.970	NKX61_RAT Homeobox protein Nkx-6.1 OS=Rattus norvegicus OX=10116 GN=Nkx6-1 PE=2 SV=1
2	P78426	0.0	717	367	1.000	1.000	NKX61_HUMAN Homeobox protein Nkx-6.1 OS=Homo sapiens OX=9606 GN=NKX6-1 PE=1 SV=2
3	Q60554	0.0	674	364	0.959	0.967	NKX61_MESAU Homeobox protein Nkx-6.1 OS=Mesocricetus auratus OX=10036 GN=NKX6-1 PE=1 SV=1
4	Q99MA9	0.0	683	365	0.965	0.970	NKX61_MOUSE Homeobox protein Nkx-6.1 OS=Mus musculus OX=10090 GN=Nkx6-1 PE=1 SV=1
5	Q6DGK5	9.30e-156	442	312	0.695	0.817	Q6DGK5_DANRE Homeobox protein Nkx-6.1 OS=Danio rerio OX=7955 GN=zgc:92879 PE=2 SV=1
6	A0A0R4IY89	5.93e-122	355	278	0.518	0.683	A0A0R4IY89_DANRE Homeobox protein Nkx-6.2 OS=Danio rerio OX=7955 GN=nkx6.2 PE=4 SV=1
7	D3Z4R4	4.50e-109	322	277	0.499	0.661	D3Z4R4_MOUSE NK6 homeobox 2 OS=Mus musculus OX=10090 GN=Nkx6-2 PE=4 SV=1
8	Q9C056	5.11e-108	319	277	0.504	0.668	NKX62_HUMAN Homeobox protein Nkx-6.2 OS=Homo sapiens OX=9606 GN=NKX6-2 PE=1 SV=2
9	Q9YHC2	6.13e-94	279	153	0.376	0.902	Q9YHC2_CHICK Homeodomain protein (Fragment) OS=Gallus gallus OX=9031 GN=Nkx-6.1 PE=2 SV=1
10	A6NJ46	5.04e-61	199	265	0.398	0.551	NKX63_HUMAN Homeobox protein Nkx-6.3 OS=Homo sapiens OX=9606 GN=NKX6-3 PE=2 SV=1
11	Q3UHX8	1.14e-60	197	262	0.398	0.557	NKX63_MOUSE Homeobox protein Nkx-6.3 OS=Mus musculus OX=10090 GN=Nkx6-3 PE=2 SV=1
12	Q8SXK1	1.71e-48	172	480	0.259	0.198	Q8SXK1_DROME RE18506p OS=Drosophila melanogaster OX=7227 GN=HGTX PE=2 SV=1
13	Q9NHP8	2.49e-48	172	513	0.259	0.185	Q9NHP8_DROME GTX/Nkx6B-like homeodomain protein OS=Drosophila melanogaster OX=7227 GN=HGTX PE=2 SV=1
14	Q8CF07	4.14e-39	140	214	0.281	0.481	Q8CF07_MOUSE Homeobox protein Nkx-6.2 OS=Mus musculus OX=10090 GN=Nkx6-2 PE=2 SV=1
15	G5EGF2	2.15e-28	108	106	0.128	0.443	G5EGF2_CAEEL COG-1B OS=Caenorhabditis elegans OX=6239 GN=cog-1 PE=2 SV=1
16	G5EGE2	1.22e-27	111	256	0.128	0.184	G5EGE2_CAEEL COG-1A OS=Caenorhabditis elegans OX=6239 GN=cog-1 PE=2 SV=1
17	O70218	3.40e-19	89.4	332	0.106	0.117	HMX1_MOUSE Homeobox protein HMX1 OS=Mus musculus OX=10090 GN=Hmx1 PE=2 SV=1
18	Q9DE09	1.43e-18	87.8	333	0.101	0.111	HMX1_CHICK Homeobox protein HMX1 OS=Gallus gallus OX=9031 GN=HMX1 PE=2 SV=1
19	Q504H8	2.30e-18	86.7	297	0.101	0.125	HMX3_DANRE Homeobox protein HMX3 OS=Danio rerio OX=7955 GN=hmx3 PE=2 SV=1
20	A9Y2A9	3.17e-18	85.9	282	0.098	0.128	A9Y2A9_DANRE Homeobox protein HMX1 OS=Danio rerio OX=7955 GN=Nkx5-3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	3.2e-17	73.4	Homeodomain
2	PF12474 PKK	95	14.6	Polo kinase kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295886

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370421	0.940	Pancreas/duodenum homeobox protein 1
2	9606.ENSP00000242462	0.903	Neurogenin-3
3	9606.ENSP00000302630	0.896	Hepatocyte nuclear factor 6
4	9606.ENSP00000365687	0.856	Pancreas transcription factor 1 subunit alpha
5	9606.ENSP00000230658	0.844	Insulin gene enhancer protein ISL-1
6	9606.ENSP00000295108	0.829	Neurogenic differentiation factor 1
7	9606.ENSP00000331040	0.827	Oligodendrocyte transcription factor 2
8	9606.ENSP00000323568	0.821	Solute carrier family 2, facilitated glucose transporter member 2
9	9606.ENSP00000387662	0.810	Glucagon
10	9606.ENSP00000400341	0.772	Hepatocyte nuclear factor 3-beta
11	9606.ENSP00000287641	0.762	Somatostatin
12	9606.ENSP00000380432	0.745	Insulin
13	9606.ENSP00000466009	0.740	Pancreatic prohormone
14	9606.ENSP00000360811	0.715	LIM/homeobox protein Lhx3
15	9606.ENSP00000340226	0.707	LIM homeobox transcription factor 1-alpha
16	9606.ENSP00000332208	0.700	DNA-binding protein RFX6
17	9606.ENSP00000369424	0.692	Histone-binding protein RBBP7
18	9606.ENSP00000362410	0.689	Transcription factor MafB
19	9606.ENSP00000245479	0.688	Transcription factor SOX-9
20	9606.ENSP00000223366	0.673	Glucokinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0005515	0.996	protein binding
GO:0000976	0.960	transcription cis-regulatory region binding
GO:0000977	0.798	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.666	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.510	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0009987	0.992	cellular process
GO:0048731	0.990	system development
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0009889	0.985	regulation of biosynthetic process
GO:0019219	0.985	regulation of nucleobase-containing compound metabolic process
GO:1903506	0.980	regulation of nucleic acid-templated transcription
GO:0031018	0.979	endocrine pancreas development
GO:0035883	0.977	enteroendocrine cell differentiation
GO:0006355	0.951	regulation of DNA-templated transcription
GO:0006357	0.938	regulation of transcription by RNA polymerase II
GO:0003309	0.880	type B pancreatic cell differentiation
GO:0048518	0.802	positive regulation of biological process
GO:0048519	0.723	negative regulation of biological process
GO:0048523	0.678	negative regulation of cellular process
GO:0050896	0.657	response to stimulus
GO:0009653	0.627	anatomical structure morphogenesis
GO:0048522	0.624	positive regulation of cellular process
GO:0007399	0.548	nervous system development
GO:0010604	0.400	positive regulation of macromolecule metabolic process
GO:0031325	0.386	positive regulation of cellular metabolic process
GO:0051173	0.383	positive regulation of nitrogen compound metabolic process
GO:0010557	0.372	positive regulation of macromolecule biosynthetic process
GO:0031328	0.368	positive regulation of cellular biosynthetic process
GO:0009887	0.367	animal organ morphogenesis
GO:0045935	0.336	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.328	positive regulation of RNA metabolic process
GO:0045893	0.321	positive regulation of DNA-templated transcription
GO:0009892	0.318	negative regulation of metabolic process
GO:0010605	0.311	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.997	nucleus
GO:0005737	0.750	cytoplasm
GO:0070013	0.728	intracellular organelle lumen
GO:0031981	0.722	nuclear lumen
GO:0005654	0.452	nucleoplasm
GO:0005829	0.419	cytosol
GO:0070062	0.353	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]