StarFunc result for job id P78504

User Input

>input (1218 residues)
MRSPRTRGRSGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICA
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPR
PCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IAF3	0.269	0.263	0.000	1254	0.532	0.517	A0A0R4IAF3.pdb.gz
2	AFDB:Q63722	0.364	0.364	0.000	1219	0.964	0.963	Q63722.pdb.gz	JAG1_RAT Protein jagged-1 OS=Rattus norvegicus OX=10116 GN=Jag1 PE=1 SV=2
3	AFDB:Q90Y54	0.326	0.327	0.000	1213	0.739	0.742	Q90Y54.pdb.gz	JAG1B_DANRE Protein jagged-1b OS=Danio rerio OX=7955 GN=jag1b PE=2 SV=1
4	AFDB:Q01705	0.090	0.051	3.671E-63	2531	0.253	0.122	Q01705.pdb.gz	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
5	AFDB:Q99466	0.107	0.074	7.082E-63	2003	0.275	0.167	Q99466.pdb.gz	NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2
6	AFDB:Q8UWJ4	0.237	0.394	1.885E-60	717	0.174	0.296	Q8UWJ4.pdb.gz	DLLD_DANRE Delta-like protein D OS=Danio rerio OX=7955 GN=dld PE=1 SV=2
7	AFDB:Q61483	0.238	0.393	2.619E-60	722	0.189	0.319	Q61483.pdb.gz	DLL1_MOUSE Delta-like protein 1 OS=Mus musculus OX=10090 GN=Dll1 PE=1 SV=2
8	AFDB:O00548	0.227	0.374	3.260E-60	723	0.186	0.314	O00548.pdb.gz	DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DLL1 PE=1 SV=2
9	AFDB:Q6DI48	0.233	0.360	1.029E-59	772	0.175	0.276	Q6DI48.pdb.gz	DLLA_DANRE Delta-like protein A OS=Danio rerio OX=7955 GN=dla PE=1 SV=1
10	AFDB:Q9JI71	0.241	0.415	1.590E-58	686	0.172	0.306	Q9JI71.pdb.gz	DLL4_MOUSE Delta-like protein 4 OS=Mus musculus OX=10090 GN=Dll4 PE=1 SV=2
11	PDB:5ixcA	0.080	0.135	7.309E-7	684	0.017	0.031	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
12	PDB:5izrC	0.080	0.140	9.611E-7	659	0.015	0.027	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
13	PDB:1cjyA	0.080	0.144	4.452E-6	633	0.017	0.033	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:5iz5A	0.083	0.128	6.531E-6	757	0.017	0.028	5iz5A.pdb.gz
15	PDB:5iz5B	0.083	0.131	6.898E-6	746	0.016	0.027	5iz5B.pdb.gz
16	PDB:3nsjA	0.084	0.173	1.012E-5	530	0.018	0.042	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
17	PDB:5a50A	0.080	0.486	1.069E-5	165	0.021	0.152	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:7q3nU	0.052	0.165	2.567E-5	292	0.026	0.110	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
19	PDB:5a52A	0.073	0.466	2.559E-4	154	0.022	0.175	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
20	PDB:6kxkD	0.085	0.170	8.078E-4	553	0.025	0.054	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18168	0.0	621	1404	0.337	0.292	SERR_DROME Protein serrate OS=Drosophila melanogaster OX=7227 GN=Ser PE=1 SV=3
2	P78504	0.0	2492	1218	1.000	1.000	JAG1_HUMAN Protein jagged-1 OS=Homo sapiens OX=9606 GN=JAG1 PE=1 SV=3
3	P97607	0.0	1210	1202	0.501	0.507	JAG2_RAT Protein jagged-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Jag2 PE=2 SV=1
4	Q5TZK7	0.0	1136	1216	0.482	0.483	Q5TZK7_DANRE Delta-like protein OS=Danio rerio OX=7955 GN=jag2 PE=4 SV=1
5	Q63722	0.0	2411	1219	0.965	0.964	JAG1_RAT Protein jagged-1 OS=Rattus norvegicus OX=10116 GN=Jag1 PE=1 SV=2
6	Q90Y54	0.0	1879	1213	0.739	0.742	JAG1B_DANRE Protein jagged-1b OS=Danio rerio OX=7955 GN=jag1b PE=2 SV=1
7	Q90Y56	0.0	1291	1254	0.534	0.518	Q90Y56_DANRE Delta-like protein OS=Danio rerio OX=7955 GN=jag2 PE=2 SV=1
8	Q90Y57	0.0	1689	1242	0.677	0.664	JAG1A_DANRE Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a PE=2 SV=1
9	Q9QXX0	0.0	2421	1218	0.966	0.966	JAG1_MOUSE Protein jagged-1 OS=Mus musculus OX=10090 GN=Jag1 PE=1 SV=1
10	Q9QYE5	0.0	1248	1247	0.511	0.500	JAG2_MOUSE Protein jagged-2 OS=Mus musculus OX=10090 GN=Jag2 PE=2 SV=2
11	Q9Y219	0.0	1268	1238	0.526	0.518	JAG2_HUMAN Protein jagged-2 OS=Homo sapiens OX=9606 GN=JAG2 PE=1 SV=3
12	P10041	2.97e-138	442	833	0.198	0.289	DL_DROME Neurogenic locus protein delta OS=Drosophila melanogaster OX=7227 GN=Delta PE=1 SV=2
13	P07207	4.54e-132	450	2703	0.225	0.101	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
14	Q61483	8.72e-132	422	722	0.181	0.306	DLL1_MOUSE Delta-like protein 1 OS=Mus musculus OX=10090 GN=Dll1 PE=1 SV=2
15	P97677	1.18e-131	421	714	0.181	0.310	DLL1_RAT Delta-like protein 1 OS=Rattus norvegicus OX=10116 GN=Dll1 PE=1 SV=1
16	O00548	1.52e-130	419	723	0.175	0.295	DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DLL1 PE=1 SV=2
17	Q6DI48	2.10e-129	417	772	0.173	0.273	DLLA_DANRE Delta-like protein A OS=Danio rerio OX=7955 GN=dla PE=1 SV=1
18	Q90656	2.84e-129	416	728	0.175	0.293	Q90656_CHICK Delta-like protein OS=Gallus gallus OX=9031 PE=2 SV=1
19	P21783	2.71e-127	436	2524	0.229	0.111	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
20	Q8UWJ4	5.52e-127	409	717	0.172	0.291	DLLD_DANRE Delta-like protein D OS=Danio rerio OX=7955 GN=dld PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	5.2	18.4	Complement Clr-like EGF-like
2	PF01414 DSL	9.1e-17	72.4	Delta serrate ligand
3	PF11144 DUF2920	7e+02	10.7	Protein of unknown function (DUF2920)
4	PF00008 EGF	4.7e-75	258.7	EGF-like domain
5	PF07974 EGF_2	6.9e-24	95.2	EGF-like domain
6	PF12947 EGF_3	3.6e-10	51.2	EGF domain
7	PF07645 EGF_CA	1.4e-07	42.9	Calcium-binding EGF domain
8	PF12661 hEGF	1.8e-47	169.7	Human growth factor-like EGF
9	PF07657 MNNL	2e-55	198.1	N terminus of Notch ligand C2-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254958

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.994	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000261537	0.993	E3 ubiquitin-protein ligase MIB1
3	9606.ENSP00000352455	0.991	Microfibrillar-associated protein 5
4	9606.ENSP00000313875	0.990	Membrane cofactor protein
5	9606.ENSP00000256646	0.984	Neurogenic locus notch homolog protein 2
6	9606.ENSP00000263388	0.984	Neurogenic locus notch homolog protein 3
7	9606.ENSP00000358795	0.978	E3 ubiquitin-protein ligase NEURL1
8	9606.ENSP00000345206	0.977	Recombining binding protein suppressor of hairless
9	9606.ENSP00000260408	0.972	Disintegrin and metalloproteinase domain-containing protein 10
10	9606.ENSP00000309968	0.969	Disintegrin and metalloproteinase domain-containing protein 17
11	9606.ENSP00000358815	0.969	E3 ubiquitin-protein ligase NEURL1B
12	9606.ENSP00000426103	0.943	E3 ubiquitin-protein ligase MIB2
13	9606.ENSP00000249749	0.941	Delta-like protein 4
14	9606.ENSP00000355718	0.941	Delta-like protein 1
15	9606.ENSP00000328169	0.939	Protein jagged-2
16	9606.ENSP00000205143	0.926	Delta-like protein 3
17	9606.ENSP00000382800	0.920	Runt-related transcription factor 3
18	9606.ENSP00000362014	0.910	Dynamin-1
19	9606.ENSP00000360798	0.909	Epidermal growth factor receptor substrate 15
20	9606.ENSP00000338272	0.891	Hairy/enhancer-of-split related with YRPW motif protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005112	1.000	Notch binding
GO:0140677	0.985	molecular function activator activity
GO:0030546	0.832	signaling receptor activator activity
GO:0048018	0.816	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.996	regulation of biological process
GO:0048856	0.996	anatomical structure development
GO:0032501	0.995	multicellular organismal process
GO:0050794	0.991	regulation of cellular process
GO:0048731	0.987	system development
GO:0050896	0.986	response to stimulus
GO:0048513	0.985	animal organ development
GO:0048518	0.977	positive regulation of biological process
GO:0051716	0.972	cellular response to stimulus
GO:0023052	0.971	signaling
GO:0007154	0.966	cell communication
GO:0019222	0.963	regulation of metabolic process
GO:0007165	0.959	signal transduction
GO:0009653	0.953	anatomical structure morphogenesis
GO:0048522	0.947	positive regulation of cellular process
GO:0007219	0.941	Notch signaling pathway
GO:0048519	0.928	negative regulation of biological process
GO:0048869	0.925	cellular developmental process
GO:0061311	0.916	cell surface receptor signaling pathway involved in heart development
GO:0030154	0.908	cell differentiation
GO:0050793	0.892	regulation of developmental process
GO:0035295	0.891	tube development
GO:0060255	0.861	regulation of macromolecule metabolic process
GO:0051171	0.857	regulation of nitrogen compound metabolic process
GO:0031323	0.857	regulation of cellular metabolic process
GO:0080090	0.855	regulation of primary metabolic process
GO:0006355	0.851	regulation of DNA-templated transcription
GO:0045595	0.846	regulation of cell differentiation
GO:0048523	0.825	negative regulation of cellular process
GO:0010604	0.808	positive regulation of macromolecule metabolic process
GO:0045596	0.789	negative regulation of cell differentiation
GO:0051173	0.780	positive regulation of nitrogen compound metabolic process
GO:0002376	0.733	immune system process
GO:0006950	0.728	response to stress
GO:0042127	0.719	regulation of cell population proliferation
GO:0045597	0.713	positive regulation of cell differentiation
GO:0051239	0.711	regulation of multicellular organismal process
GO:0001944	0.701	vasculature development
GO:0007399	0.692	nervous system development
GO:0003279	0.677	cardiac septum development
GO:0031325	0.675	positive regulation of cellular metabolic process
GO:0009888	0.674	tissue development
GO:0003206	0.665	cardiac chamber morphogenesis
GO:0060411	0.658	cardiac septum morphogenesis
GO:0051240	0.647	positive regulation of multicellular organismal process
GO:0048844	0.630	artery morphogenesis
GO:0048583	0.610	regulation of response to stimulus
GO:0060429	0.593	epithelium development
GO:0048468	0.590	cell development
GO:0030855	0.555	epithelial cell differentiation
GO:0003170	0.554	heart valve development
GO:0010557	0.539	positive regulation of macromolecule biosynthetic process
GO:0045935	0.539	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.538	positive regulation of cellular biosynthetic process
GO:0006357	0.534	regulation of transcription by RNA polymerase II
GO:0045893	0.527	positive regulation of DNA-templated transcription
GO:0022008	0.489	neurogenesis
GO:0072001	0.482	renal system development
GO:0048699	0.460	generation of neurons
GO:0048584	0.458	positive regulation of response to stimulus
GO:0030182	0.434	neuron differentiation
GO:0007423	0.425	sensory organ development
GO:0008544	0.414	epidermis development
GO:0009892	0.406	negative regulation of metabolic process
GO:0009966	0.405	regulation of signal transduction
GO:0042491	0.398	inner ear auditory receptor cell differentiation
GO:2000145	0.347	regulation of cell motility
GO:0030334	0.344	regulation of cell migration
GO:0010605	0.344	negative regulation of macromolecule metabolic process
GO:0023056	0.331	positive regulation of signaling
GO:0010647	0.331	positive regulation of cell communication
GO:0048863	0.312	stem cell differentiation
GO:0098727	0.300	maintenance of cell number

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.619	intracellular anatomical structure
GO:0070013	0.362	intracellular organelle lumen
GO:0005634	0.301	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]