StarFunc result for job id P78509

User Input

>input (1400 residues)
MERSGWARQTFLLALLLGATLRARAAAGYYPRFSPFFFLCTHHGELEGDGEQGEVLISLH
IAGNPTYYVPGQEYHVTISTSTFFDGLLVTGLYTSTSVQASQSIGGSSAFGFGIMSDHQF
GNQFMCSVVASHVSHLPTTNLSFIWIAPPAGTGCVNFMATATHRGQVIFKDALAQQLCEQ
GAPTDVTVHPHLAEIHSDSIILRDDFDSYHQLQLNPNIWVECNNCETGEQCGAIMHGNAV
TFCEPYGPRELITTGLNTTTASVLQFSIGSGSCRFSYSDPSIIVLYAKNNSADWIQLEKI
RAPSNVSTIIHILYLPEDAKGENVQFQWKQENLRVGEVYEACWALDNILIINSAHRQVVL
EDSLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSEFNFATTRDVDLSTEDIQEQW
SEEFESQPTGWDVLGAVIGTECGTIESGLSMVFLKDGERKLCTPSMDTTGYGNLRFYFVM
GGICDPGNSHENDIILYAKIEGRKEHITLDTLSYSSYKVPSLVSVVINPELQTPATKFCL
RQKNHQGHNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGTHQPGNSVSLEFSTNHGRS
WSLLHTECLPEICAGPHLPHSTVYSSENYSGWNRITIPLPNAALTRNTRIRWRQTGPILG
NMWAIDNVYIGPSCLKFCSGRGQCTRHGCKCDPGFSGPACEMASQTFPMFISESFGSSRL
SSYHNFYSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQFTLRLGSKS
VLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYLSYHEPRIISVELPGDAKQFGIQFR
WWQPYHSSQREDVWAIDEIIMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQPYCGHDWTL
CFTGDSKLASSMRYVETQSMQIGASYMIQFSLVMGCGQKYTPHMDNQVKLEYSTNHGLTW
HLVQEECLPSMPSCQEFTSASIYHASEFTQWRRVIVLLPQKTWSSATRFRWSQSYYTAQD
EWALDSIYIGQQCPNMCSGHGSCDHGICRCDQGYQGTECHPEAALPSTIMSDFENQNGWE
SDWQEVIGGEIVKPEQGCGVISSGSSLYFSKAGKRQLVSWDLDTSWVDFVQFYIQIGGES
ASCNKPDSREEGVLLQYSNNGGIQWHLLAEMYFSDFSKPRFVYLELPAAAKTPCTRFRWW
QPVFSGEDYDQWAVDDIIILSEKQKQIIPVINPTLPQNFYEKPAFDYPMNQMSVWLMLAN
EGMVKNETFCAATPSAMIFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCANQFSSTAPVL
LQYSHDAGMSWFLVKEGCYPASAGKGCEGNSRELSEPTMYHTGDFEEWTRITIVIPRSLA
SSKTRFRWIQESSSQKNVPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8AXK7	0.237	0.293	5.186E-60	1078	0.202	0.263	Q8AXK7.pdb.gz
2	AFDB:A2AJX4	0.093	0.073	4.523E-31	2123	0.122	0.081	A2AJX4.pdb.gz	MALR1_MOUSE MAM and LDL-receptor class A domain-containing protein 1 OS=Mus musculus OX=10090 GN=Malrd1 PE=1 SV=2
3	AFDB:Q5VYJ5	0.110	0.081	4.324E-29	2156	0.129	0.084	Q5VYJ5.pdb.gz	MALR1_HUMAN MAM and LDL-receptor class A domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MALRD1 PE=1 SV=4
4	AFDB:Q7Z304	0.111	0.206	1.510E-16	686	0.076	0.155	Q7Z304.pdb.gz	MAMC2_HUMAN MAM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAMDC2 PE=1 SV=3
5	AFDB:Q8CG85	0.108	0.185	8.822E-16	686	0.064	0.131	Q8CG85.pdb.gz	MAMC2_MOUSE MAM domain-containing protein 2 OS=Mus musculus OX=10090 GN=Mamdc2 PE=1 SV=1
6	AFDB:P79795	0.096	0.143	4.237E-15	914	0.081	0.124	P79795.pdb.gz	NRP1_CHICK Neuropilin-1 OS=Gallus gallus OX=9031 GN=NRP1 PE=2 SV=1
7	AFDB:O14786	0.082	0.121	2.357E-14	923	0.086	0.131	O14786.pdb.gz	NRP1_HUMAN Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=3
8	AFDB:Q6T491	0.109	0.153	4.459E-14	921	0.068	0.103	Q6T491.pdb.gz
9	AFDB:Q8QFX6	0.084	0.123	6.601E-14	923	0.076	0.116	Q8QFX6.pdb.gz	NRP1A_DANRE Neuropilin-1a OS=Danio rerio OX=7955 GN=nrp1a PE=2 SV=1
10	AFDB:O35375	0.087	0.127	7.281E-14	931	0.069	0.103	O35375.pdb.gz	NRP2_MOUSE Neuropilin-2 OS=Mus musculus OX=10090 GN=Nrp2 PE=1 SV=2
11	PDB:6vlsD	0.085	0.117	6.456E-7	963	0.041	0.059	6vlsD.pdb.gz
12	PDB:7vonA	0.073	0.073	6.456E-7	1399	0.061	0.061	7vonA.pdb.gz
13	PDB:7q1yA	0.066	0.067	2.548E-6	1374	0.078	0.079	7q1yA.pdb.gz
14	PDB:3lxuX	0.087	0.096	6.470E-6	1217	0.048	0.055	3lxuX.pdb.gz
15	PDB:5eiyB	0.077	0.145	9.119E-6	658	0.028	0.059	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
16	PDB:7l2zF	0.063	0.122	1.812E-5	664	0.031	0.066	7l2zF.pdb.gz
17	PDB:4lnvB	0.080	0.097	1.998E-5	1063	0.055	0.072	4lnvB.pdb.gz
18	PDB:4bxsV	0.079	0.086	3.599E-5	1262	0.025	0.028	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
19	PDB:7q5zA	0.075	0.077	5.073E-5	1344	0.071	0.074	7q5zA.pdb.gz
20	PDB:7kveB	0.059	0.060	2.209E-4	1374	0.052	0.053	7kveB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G1BJ50	0.0	2051	3468	0.680	0.275	G1BJ50_DANRE Reelin OS=Danio rerio OX=7955 GN=reln PE=2 SV=1
2	O93574	0.0	2185	3209	0.735	0.321	RELN_CHICK Reelin (Fragment) OS=Gallus gallus OX=9031 GN=RELN PE=2 SV=1
3	P58751	0.0	2708	3462	0.926	0.375	RELN_RAT Reelin OS=Rattus norvegicus OX=10116 GN=Reln PE=2 SV=1
4	P78509	0.0	2914	3460	1.000	0.405	RELN_HUMAN Reelin OS=Homo sapiens OX=9606 GN=RELN PE=1 SV=3
5	Q60841	0.0	2704	3461	0.929	0.376	RELN_MOUSE Reelin OS=Mus musculus OX=10090 GN=Reln PE=1 SV=3
6	Q6Q144	0.0	1937	3008	0.654	0.305	Q6Q144_BOVIN Reelin (Fragment) OS=Bos taurus OX=9913 GN=RELN PE=2 SV=1
7	Q9HCB6	6.44e-14	79.3	807	0.036	0.062	SPON1_HUMAN Spondin-1 OS=Homo sapiens OX=9606 GN=SPON1 PE=1 SV=2
8	Q8VCC9	1.76e-13	77.8	807	0.035	0.061	SPON1_MOUSE Spondin-1 OS=Mus musculus OX=10090 GN=Spon1 PE=1 SV=1
9	O42114	5.34e-09	63.2	803	0.028	0.049	O42114_DANRE Spondin-1 OS=Danio rerio OX=7955 GN=cb1051 PE=2 SV=1
10	F1R2Z9	6.02e-09	63.2	804	0.028	0.049	F1R2Z9_DANRE Spondin-1 OS=Danio rerio OX=7955 GN=F-spondin2 PE=4 SV=3
11	Q8I7T3	7.22e-05	50.1	952	0.019	0.027	SADA_DICDI Substrate-adhesion molecule OS=Dictyostelium discoideum OX=44689 GN=sadA PE=2 SV=1
12	Q7KN04	1.10e-04	49.3	763	0.027	0.050	Q7KN04_DROME Spondin-1 OS=Drosophila melanogaster OX=7227 GN=fat-spondin PE=1 SV=1
13	A0A8I6ARC1	4.93e-04	47.4	2202	0.013	0.008	A0A8I6ARC1_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
14	A0A0G2K1L0	4.99e-04	47.4	2110	0.013	0.009	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
15	Q80YX1	5.25e-04	47.4	2110	0.013	0.009	TENA_MOUSE Tenascin OS=Mus musculus OX=10090 GN=Tnc PE=1 SV=1
16	Q92752	5.51e-04	47.0	1358	0.013	0.013	TENR_HUMAN Tenascin-R OS=Homo sapiens OX=9606 GN=TNR PE=1 SV=3
17	A1L306	5.73e-04	47.0	1257	0.013	0.014	A1L306_HUMAN TNR protein OS=Homo sapiens OX=9606 GN=TNR PE=1 SV=1
18	A0A8I6AG89	5.94e-04	47.0	2019	0.013	0.009	A0A8I6AG89_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
19	B2LYI9	6.19e-04	47.0	2019	0.013	0.009	B2LYI9_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=2 SV=1
20	A0A8I6GHT4	6.88e-04	47.0	1928	0.013	0.009	A0A8I6GHT4_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02012 BNR	1.9e-07	40.8	BNR/Asp-box repeat
2	PF01683 EB	56	15.4	EB module
3	PF07974 EGF_2	0.33	22.6	EGF-like domain
4	PF02014 Reeler	0.00069	31.8	Reeler domain
5	PF15902 Sortilin-Vps10	5.5e+02	10.7	Sortilin, neurotensin receptor 3,

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392423

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303634	0.999	Low-density lipoprotein receptor-related protein 8
2	9606.ENSP00000371532	0.999	Very low-density lipoprotein receptor
3	9606.ENSP00000360280	0.992	Disabled homolog 1
4	9606.ENSP00000252486	0.988	Apolipoprotein E
5	9606.ENSP00000380378	0.982	Platelet-activating factor acetylhydrolase IB subunit alpha
6	9606.ENSP00000007722	0.963	Integrin alpha-3
7	9606.ENSP00000284981	0.963	Amyloid-beta A4 protein
8	9606.ENSP00000346671	0.961	Tyrosine-protein kinase Fyn
9	9606.ENSP00000477455	0.961	Glutamate receptor ionotropic, NMDA 2B
10	9606.ENSP00000379818	0.958	Glutamate receptor ionotropic, NMDA 2A
11	9606.ENSP00000379350	0.952	Integrin beta-1
12	9606.ENSP00000361263	0.946	Rap guanine nucleotide exchange factor 1
13	9606.ENSP00000296755	0.942	Microtubule-associated protein 1B
14	9606.ENSP00000346300	0.942	Crk-like protein
15	9606.ENSP00000444935	0.937	Platelet-activating factor acetylhydrolase IB subunit gamma
16	9606.ENSP00000451828	0.936	RAC-alpha serine/threonine-protein kinase
17	9606.ENSP00000435289	0.929	Platelet-activating factor acetylhydrolase IB subunit beta
18	9606.ENSP00000233154	0.921	Cytoplasmic protein NCK2
19	9606.ENSP00000378974	0.916	Mitogen-activated protein kinase 8
20	9606.ENSP00000263967	0.914	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0070325	0.992	lipoprotein particle receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007399	0.965	nervous system development
GO:0050896	0.927	response to stimulus
GO:0021510	0.923	spinal cord development
GO:0009987	0.921	cellular process
GO:0050890	0.874	cognition
GO:0021761	0.862	limbic system development
GO:0007610	0.858	behavior
GO:0021543	0.838	pallium development
GO:0044093	0.828	positive regulation of molecular function
GO:0019222	0.821	regulation of metabolic process
GO:0031323	0.811	regulation of cellular metabolic process
GO:0051716	0.796	cellular response to stimulus
GO:0051347	0.790	positive regulation of transferase activity
GO:0007611	0.776	learning or memory
GO:0045860	0.775	positive regulation of protein kinase activity
GO:0048699	0.769	generation of neurons
GO:0042221	0.766	response to chemical
GO:0023051	0.762	regulation of signaling
GO:0010646	0.762	regulation of cell communication
GO:0048583	0.760	regulation of response to stimulus
GO:0050731	0.756	positive regulation of peptidyl-tyrosine phosphorylation
GO:0021987	0.720	cerebral cortex development
GO:0050793	0.717	regulation of developmental process
GO:0021766	0.714	hippocampus development
GO:0016477	0.709	cell migration
GO:0055123	0.707	digestive system development
GO:0022604	0.704	regulation of cell morphogenesis
GO:0009966	0.699	regulation of signal transduction
GO:1901700	0.698	response to oxygen-containing compound
GO:0061098	0.698	positive regulation of protein tyrosine kinase activity
GO:2000145	0.696	regulation of cell motility
GO:0010769	0.694	regulation of cell morphogenesis involved in differentiation
GO:0030334	0.692	regulation of cell migration
GO:0021517	0.679	ventral spinal cord development
GO:0001764	0.674	neuron migration
GO:0007613	0.671	memory
GO:0019538	0.670	protein metabolic process
GO:0010975	0.669	regulation of neuron projection development
GO:0034330	0.663	cell junction organization
GO:0023056	0.660	positive regulation of signaling
GO:0010647	0.659	positive regulation of cell communication
GO:0051179	0.648	localization
GO:0050804	0.648	modulation of chemical synaptic transmission
GO:0051239	0.644	regulation of multicellular organismal process
GO:0030182	0.643	neuron differentiation
GO:0044237	0.634	cellular metabolic process
GO:0065008	0.633	regulation of biological quality
GO:1902074	0.627	response to salt
GO:0051240	0.626	positive regulation of multicellular organismal process
GO:0021511	0.626	spinal cord patterning
GO:0009719	0.624	response to endogenous stimulus
GO:0045595	0.618	regulation of cell differentiation
GO:0036211	0.617	protein modification process
GO:0014070	0.613	response to organic cyclic compound
GO:2000026	0.611	regulation of multicellular organismal development
GO:0006950	0.605	response to stress
GO:0048565	0.596	digestive tract development
GO:0051641	0.595	cellular localization
GO:0048666	0.591	neuron development
GO:1901654	0.587	response to ketone
GO:0033993	0.585	response to lipid
GO:0009725	0.574	response to hormone
GO:0071495	0.556	cellular response to endogenous stimulus
GO:1902531	0.539	regulation of intracellular signal transduction
GO:1901655	0.521	cellular response to ketone
GO:0009967	0.520	positive regulation of signal transduction
GO:0009611	0.484	response to wounding
GO:0030030	0.470	cell projection organization
GO:0048678	0.423	response to axon injury
GO:0050808	0.379	synapse organization
GO:0031175	0.379	neuron projection development
GO:0071407	0.370	cellular response to organic cyclic compound
GO:0032870	0.369	cellular response to hormone stimulus
GO:0071396	0.359	cellular response to lipid
GO:0032879	0.332	regulation of localization
GO:0007154	0.304	cell communication
GO:0009653	0.301	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.975	intracellular anatomical structure
GO:0005737	0.974	cytoplasm
GO:0071944	0.939	cell periphery
GO:0042995	0.865	cell projection
GO:0120025	0.845	plasma membrane bounded cell projection
GO:0032991	0.798	protein-containing complex
GO:0043005	0.793	neuron projection
GO:0036477	0.771	somatodendritic compartment
GO:0097447	0.347	dendritic tree
GO:0030425	0.335	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]