StarFunc result for job id P78524

User Input

>input (1137 residues)
MTMTANKNSSITHGAGGTKAPRGTLSRSQSVSPPPVLSPPRSPIYPLSDSETSACRYPSH
SSSRVLLKDRHPPAPSPQNPQDPSPDTSPPTCPFKTASFGYLDRSPSACKRDAQKESVQG
AAQDVAGVAACLPLAQSTPFPGPAAGPRGVLLTRTGTRAHSLGIREKISAWEGRREASPR
MSMCGEKREGSGSEWAASEGCPSLGCPSVVPSPCSSEKTFDFKGLRRMSRTFSECSYPET
EEEGEALPVRDSFYRLEKRLGRSEPSAFLRGHGSRKESSAVLSRIQKIEQVLKEQPGRGL
PQLPSSCYSVDRGKRKTGTLGSLEEPAGGASVSAGSRAVGVAGVAGEAGPPPEREGSGST
KPGTPGNSPSSQRLPSKSSLDPAVNPVPKPKRTFEYEADKNPKSKPSNGLPPSPTPAAPP
PLPSTPAPPVTRRPKKDMRGHRKSQSRKSFEFEDASSLQSLYPSSPTENGTENQPKFGSK
STLEENAYEDIVGDLPKENPYEDVDLKSRRAGRKSQQLSENSLDSLHRMWSPQDRKYNSP
PTQLSLKPNSQSLRSGNWSERKSHRLPRLPKRHSHDDMLLLAQLSLPSSPSSLNEDSLST
TSELLSSRRARRIPKLVQRINSIYNAKRGKKRLKKLSMSSIETASLRDENSESESDSDDR
FKAHTQRLVHIQSMLKRAPSYRTLELELLEWQERELFEYFVVVSLKKKPSRNTYLPEVSY
QFPKLDRPTKQMREAEERLKAIPQFCFPDAKDWLPVSEYSSETFSFMLTGEDGSRRFGYC
RRLLPSGKGPRLPEVYCVISRLGCFGLFSKVLDEVERRRGISAALVYPFMRSLMESPFPA
PGKTIKVKTFLPGAGNEVLELRRPMDSRLEHVDFECLFTCLSVRQLIRIFASLLLERRVI
FVADKLSTLSSCSHAVVALLYPFSWQHTFIPVLPASMIDIVCCPTPFLVGLLSSSLPKLK
ELPVEEALMVNLGSDRFIRQMDDEDTLLPRKLQAALEQALERKNELISQDSDSDSDDECN
TLNGLVSEVFIRFFVETVGHYSLFLTQSEKGERAFQREAFRKSVASKSIRRFLEVFMESQ
MFAGFIQDRELRKCRAKGLFEQRVEQYLEELPDTEQSGMNKFLRGLGNKMKFLHKKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78524	1.000	1.000	0.000	1137	1.000	1.000	P78524.pdb.gz	DEN2B_HUMAN DENN domain-containing protein 2B OS=Homo sapiens OX=9606 GN=DENND2B PE=1 SV=3
2	AFDB:Q8TEH3	0.303	0.339	1.745E-11	1009	0.104	0.117	Q8TEH3.pdb.gz	DEN1A_HUMAN DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
3	AFDB:Q8K382	0.303	0.337	7.353E-11	1016	0.103	0.115	Q8K382.pdb.gz	DEN1A_MOUSE DENN domain-containing protein 1A OS=Mus musculus OX=10090 GN=Dennd1a PE=1 SV=2
4	PDB:6nzdH	0.094	0.238	3.144E-5	387	0.054	0.158	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
5	AFDB:A6H8H2	0.285	0.176	1.104E-4	1906	0.077	0.046	A6H8H2.pdb.gz	DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus OX=10090 GN=Dennd4c PE=1 SV=1
6	PDB:6ulgL	0.112	0.227	2.380E-4	458	0.052	0.129	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
7	PDB:7mgeC	0.113	0.267	5.291E-4	365	0.042	0.132	7mgeC.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
8	PDB:8dhbJ	0.109	0.278	1.241E-3	361	0.038	0.119	8dhbJ.pdb.gz	Structural basis for FLCN RagC GAP activation in MiT-TFE substrate-selective mTORC1 regulation.
9	PDB:6lt0B	0.081	0.198	5.227E-3	386	0.039	0.114	6lt0B.pdb.gz
10	PDB:6lt0C	0.113	0.260	7.588E-3	385	0.034	0.101	6lt0C.pdb.gz
11	PDB:2wkpA	0.071	0.207	3.372E-2	320	0.035	0.125	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
12	PDB:7mgeB	0.071	0.160	3.751E-2	442	0.041	0.106	7mgeB.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
13	PDB:7o2wB	0.091	0.214	8.795E-2	422	0.016	0.043	7o2wB.pdb.gz
14	PDB:6sh3A	0.062	0.150	1.211E-1	376	0.033	0.101	6sh3A.pdb.gz	Structure of the Bcs1 AAA-ATPase suggests an airlock-like translocation mechanism for folded proteins.
15	AFDB:F1Q6T9	0.063	0.062	1.545E-1	1168	0.099	0.097	F1Q6T9.pdb.gz	F1Q6T9_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=2
16	AFDB:Q54I36	0.040	0.036	3.434E-1	1338	0.093	0.079	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
17	AFDB:Q9VB52	0.043	0.036	3.434E-1	1477	0.100	0.077	Q9VB52.pdb.gz	Q9VB52_DROME LD05287p OS=Drosophila melanogaster OX=7227 GN=l(3)mbt PE=1 SV=1
18	AFDB:Q9BX66	0.035	0.032	4.249E-1	1292	0.128	0.112	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
19	AFDB:P91621	0.047	0.034	4.482E-1	2072	0.122	0.067	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
20	AFDB:A2AKX3	0.053	0.035	7.238E-1	2646	0.149	0.064	A2AKX3.pdb.gz	SETX_MOUSE Probable helicase senataxin OS=Mus musculus OX=10090 GN=Setx PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78524	0.0	2306	1137	1.000	1.000	DEN2B_HUMAN DENN domain-containing protein 2B OS=Homo sapiens OX=9606 GN=DENND2B PE=1 SV=3
2	Q68D51	0.0	738	928	0.393	0.482	DEN2C_HUMAN DENN domain-containing protein 2C OS=Homo sapiens OX=9606 GN=DENND2C PE=1 SV=2
3	Q9ULE3	0.0	789	1009	0.450	0.507	DEN2A_HUMAN DENN domain-containing protein 2A OS=Homo sapiens OX=9606 GN=DENND2A PE=1 SV=4
4	Q9H6A0	7.16e-140	432	471	0.186	0.448	DEN2D_HUMAN DENN domain-containing protein 2D OS=Homo sapiens OX=9606 GN=DENND2D PE=1 SV=2
5	Q8TEH3	4.45e-41	166	1009	0.099	0.111	DEN1A_HUMAN DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
6	A0A0A0MS48	5.96e-41	166	1070	0.099	0.105	A0A0A0MS48_HUMAN DENN domain containing 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
7	Q8K382	7.96e-41	166	1016	0.098	0.109	DEN1A_MOUSE DENN domain-containing protein 1A OS=Mus musculus OX=10090 GN=Dennd1a PE=1 SV=2
8	Q3U1T9	6.74e-37	152	766	0.101	0.150	DEN1B_MOUSE DENN domain-containing protein 1B OS=Mus musculus OX=10090 GN=Dennd1b PE=1 SV=3
9	Q6P3S1	1.30e-34	145	775	0.097	0.142	DEN1B_HUMAN DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2
10	Q8IV53	6.89e-32	136	801	0.093	0.132	DEN1C_HUMAN DENN domain-containing protein 1C OS=Homo sapiens OX=9606 GN=DENND1C PE=1 SV=1
11	G5ECW9	1.45e-23	109	661	0.079	0.136	G5ECW9_CAEEL UDENN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rme-4 PE=1 SV=1
12	Q9W3D3	5.53e-20	99.4	1671	0.124	0.084	CRAG_DROME DENN domain-containing protein Crag OS=Drosophila melanogaster OX=7227 GN=Crag PE=1 SV=3
13	O02626	2.06e-16	87.4	1409	0.073	0.059	MADD_CAEEL MAP kinase-activating death domain protein OS=Caenorhabditis elegans OX=6239 GN=aex-3 PE=1 SV=1
14	Q8RXA7	7.65e-16	85.5	1187	0.070	0.067	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
15	Q5VZ89	1.00e-15	85.5	1909	0.089	0.053	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
16	Q6IQ26	5.07e-15	82.8	1287	0.042	0.037	DEN5A_HUMAN DENN domain-containing protein 5A OS=Homo sapiens OX=9606 GN=DENND5A PE=1 SV=2
17	G3V7Q0	5.29e-15	82.8	1287	0.042	0.037	DEN5A_RAT DENN domain-containing protein 5A OS=Rattus norvegicus OX=10116 GN=Dennd5a PE=2 SV=1
18	Q6PAL8	5.38e-15	82.8	1287	0.042	0.037	DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus OX=10090 GN=Dennd5a PE=1 SV=1
19	Q7Z401	2.40e-14	80.9	1863	0.088	0.054	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
20	A2RT67	9.03e-14	79.0	1274	0.085	0.076	DEND3_MOUSE DENN domain-containing protein 3 OS=Mus musculus OX=10090 GN=Dennd3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03455 dDENN	2.7e-09	48.2	dDENN domain
2	PF02141 DENN	5.4e-55	197.7	DENN (AEX-3) domain
3	PF03456 uDENN	4.4e-10	51.2	uDENN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000433528

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357564	0.937	Ras-related protein Rab-13
2	9606.ENSP00000420127	0.934	Ras-related protein Rab-9A
3	9606.ENSP00000243298	0.931	Ras-related protein Rab-9B
4	9606.ENSP00000350386	0.920	Rab proteins geranylgeranyltransferase component A 1
5	9606.ENSP00000355511	0.920	Rab proteins geranylgeranyltransferase component A 2
6	9606.ENSP00000369538	0.901	Rab GDP dissociation inhibitor beta
7	9606.ENSP00000394071	0.901	Rab GDP dissociation inhibitor alpha
8	9606.ENSP00000429969	0.827	Signal peptide, CUB domain and EGF like domain containing 2
9	9606.ENSP00000260130	0.803	Syntenin-1
10	9606.ENSP00000361423	0.789	Tyrosine-protein kinase ABL1
11	9606.ENSP00000215743	0.761	Stromelysin-3
12	9606.ENSP00000254436	0.721	E3 ubiquitin-protein ligase TRIM21
13	9606.ENSP00000261692	0.705	Cyclin-dependent kinase 2-associated protein 1
14	9606.ENSP00000414237	0.705	Integrator complex subunit 2
15	9606.ENSP00000227155	0.669	CD82 antigen
16	9606.ENSP00000371230	0.664	GTP:AMP phosphotransferase AK3, mitochondrial
17	9606.ENSP00000378743	0.654	Adenylate kinase 4, mitochondrial
18	9606.ENSP00000338207	0.650	Rhombotin-1
19	9606.ENSP00000216218	0.645	Hsc70-interacting protein
20	9606.ENSP00000362870	0.603	Cartilage matrix protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048522	0.972	positive regulation of cellular process
GO:1902531	0.967	regulation of intracellular signal transduction
GO:0043408	0.955	regulation of MAPK cascade
GO:0070372	0.910	regulation of ERK1 and ERK2 cascade
GO:0048584	0.908	positive regulation of response to stimulus
GO:0043410	0.899	positive regulation of MAPK cascade
GO:0009987	0.851	cellular process
GO:0070374	0.538	positive regulation of ERK1 and ERK2 cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.999	cytosol
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0043227	0.970	membrane-bounded organelle
GO:0043231	0.960	intracellular membrane-bounded organelle
GO:0070013	0.890	intracellular organelle lumen
GO:0031981	0.825	nuclear lumen
GO:0005654	0.808	nucleoplasm
GO:0005856	0.571	cytoskeleton
GO:0016020	0.383	membrane
GO:0005886	0.369	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]