StarFunc result for job id P78536

User Input

>input (824 residues)
MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDL
QTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVV
GEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQS
PKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM
AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC
KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMD
SASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKD
PFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z0F8	0.762	0.760	0.000	827	0.920	0.917	Q9Z0F8.pdb.gz	ADA17_MOUSE Disintegrin and metalloproteinase domain-containing protein 17 OS=Mus musculus OX=10090 GN=Adam17 PE=1 SV=3
2	AFDB:Q9VAC5	0.480	0.538	1.157E-73	732	0.351	0.395	Q9VAC5.pdb.gz	ADA17_DROME ADAM 17-like protease OS=Drosophila melanogaster OX=7227 GN=Tace PE=2 SV=2
3	AFDB:Q94316	0.481	0.555	1.571E-55	686	0.240	0.289	Q94316.pdb.gz	ADA17_CAEEL Disintegrin and metalloproteinase domain-containing protein 17 homolog OS=Caenorhabditis elegans OX=6239 GN=adm-4 PE=3 SV=1
4	AFDB:Q9VAI2	0.406	0.225	4.982E-42	1537	0.262	0.141	Q9VAI2.pdb.gz	Q9VAI2_DROME Kuzbanian-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Kul PE=4 SV=1
5	AFDB:Q7ZYZ9	0.339	0.333	5.306E-32	843	0.174	0.170	Q7ZYZ9.pdb.gz	Q7ZYZ9_DANRE A disintegrin and metalloproteinase domain 8a OS=Danio rerio OX=7955 GN=adam8 PE=2 SV=2
6	AFDB:Q9P0K1	0.337	0.309	1.559E-31	906	0.209	0.190	Q9P0K1.pdb.gz	ADA22_HUMAN Disintegrin and metalloproteinase domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ADAM22 PE=1 SV=1
7	AFDB:Q400M8	0.360	0.310	8.958E-29	975	0.183	0.155	Q400M8.pdb.gz	Q400M8_DROME Meltrin, isoform D OS=Drosophila melanogaster OX=7227 GN=Meltrin PE=1 SV=2
8	PDB:4q1lA	0.198	0.751	2.641E-9	202	0.053	0.218	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
9	PDB:7ufgB	0.176	0.129	2.042E-3	1182	0.062	0.043	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
10	PDB:5kzwA	0.092	0.090	3.686E-2	850	0.041	0.040	5kzwA.pdb.gz	The structure of human GAA: structural basis of Pompe disease
11	PDB:5m1iA	0.064	0.079	3.686E-2	539	0.059	0.091	5m1iA.pdb.gz	Structural Snapshots for Mechanism-Based Inactivation of a Glycoside Hydrolase by Cyclopropyl Carbasugars.
12	PDB:4binA	0.071	0.131	8.633E-2	348	0.025	0.060	4binA.pdb.gz	The Crystal Structure of the Cell Division Amidase Amic Reveals the Fold of the Amin Domain, a New Peptidoglycan Binding Domain.
13	PDB:3k7pA	0.070	0.258	9.137E-2	153	0.016	0.085	3k7pA.pdb.gz	Structures of type B ribose 5-phosphate isomerase from Trypanosoma cruzi shed light on the determinants of sugar specificity in the structural family.
14	PDB:5t43A	0.062	0.215	1.438E-1	158	0.015	0.076	5t43A.pdb.gz
15	PDB:6fxsA	0.069	0.259	1.522E-1	149	0.015	0.081	6fxsA.pdb.gz
16	PDB:6e5lA	0.064	0.271	1.611E-1	140	0.022	0.129	6e5lA.pdb.gz	Abnormal Cannabidiol Modulates Vitamin A Metabolism by Acting as a Competitive Inhibitor of CRBP1.
17	PDB:7e16A	0.075	0.232	1.611E-1	207	0.017	0.068	7e16A.pdb.gz
18	AFDB:B9VQL3	0.057	0.078	4.166E-1	565	0.056	0.081	B9VQL3.pdb.gz
19	AFDB:Q8UWJ4	0.057	0.063	5.532E-1	717	0.052	0.060	Q8UWJ4.pdb.gz	DLLD_DANRE Delta-like protein D OS=Danio rerio OX=7955 GN=dld PE=1 SV=2
20	AFDB:Q8SYK5	0.052	0.107	5.855E-1	376	0.045	0.098	Q8SYK5.pdb.gz	INSV_DROME Protein insensitive OS=Drosophila melanogaster OX=7227 GN=insv PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RNB2	0.0	1720	824	1.000	1.000	B2RNB2_HUMAN ADAM metallopeptidase domain 17 OS=Homo sapiens OX=9606 GN=ADAM17 PE=2 SV=1
2	P78536	0.0	1720	824	1.000	1.000	ADA17_HUMAN Disintegrin and metalloproteinase domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ADAM17 PE=1 SV=1
3	Q9Z0F8	0.0	1601	827	0.921	0.918	ADA17_MOUSE Disintegrin and metalloproteinase domain-containing protein 17 OS=Mus musculus OX=10090 GN=Adam17 PE=1 SV=3
4	Q9Z1K9	0.0	1604	827	0.925	0.921	ADA17_RAT Disintegrin and metalloproteinase domain-containing protein 17 OS=Rattus norvegicus OX=10116 GN=Adam17 PE=1 SV=1
5	Q9VAC5	7.81e-173	518	732	0.357	0.402	ADA17_DROME ADAM 17-like protease OS=Drosophila melanogaster OX=7227 GN=Tace PE=2 SV=2
6	Q94316	7.87e-84	284	686	0.201	0.242	ADA17_CAEEL Disintegrin and metalloproteinase domain-containing protein 17 homolog OS=Caenorhabditis elegans OX=6239 GN=adm-4 PE=3 SV=1
7	O77636	2.06e-72	234	112	0.133	0.982	ADA17_PIG Disintegrin and metalloproteinase domain-containing protein 17 OS=Sus scrofa OX=9823 GN=ADAM17 PE=1 SV=2
8	Q10741	5.91e-69	244	748	0.229	0.253	ADA10_BOVIN Disintegrin and metalloproteinase domain-containing protein 10 OS=Bos taurus OX=9913 GN=ADAM10 PE=1 SV=1
9	O14672	1.68e-68	243	748	0.237	0.261	ADA10_HUMAN Disintegrin and metalloproteinase domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ADAM10 PE=1 SV=1
10	O35598	1.27e-66	238	749	0.250	0.275	ADA10_MOUSE Disintegrin and metalloproteinase domain-containing protein 10 OS=Mus musculus OX=10090 GN=Adam10 PE=1 SV=2
11	Q10743	2.17e-66	237	749	0.243	0.267	ADA10_RAT Disintegrin and metalloproteinase domain-containing protein 10 OS=Rattus norvegicus OX=10116 GN=Adam10 PE=1 SV=2
12	Q9VAI2	1.04e-56	214	1537	0.182	0.098	Q9VAI2_DROME Kuzbanian-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Kul PE=4 SV=1
13	G5EFD9	6.99e-44	173	922	0.206	0.184	ADA10_CAEEL Disintegrin and metalloproteinase domain-containing protein 10 homolog OS=Caenorhabditis elegans OX=6239 GN=sup-17 PE=1 SV=1
14	A8DZ02	7.95e-41	164	1219	0.188	0.127	A8DZ02_DROME Kuzbanian, isoform F OS=Drosophila melanogaster OX=7227 GN=kuz PE=1 SV=2
15	Q9VJW9	9.81e-41	164	1238	0.188	0.125	Q9VJW9_DROME Kuzbanian, isoform A OS=Drosophila melanogaster OX=7227 GN=kuz PE=1 SV=1
16	Q94902	9.82e-41	164	1239	0.188	0.125	Q94902_DROME Kuzbanian OS=Drosophila melanogaster OX=7227 GN=kuz PE=2 SV=1
17	Q59DZ3	1.10e-40	164	1090	0.188	0.142	Q59DZ3_DROME FI21209p1 OS=Drosophila melanogaster OX=7227 GN=kuz PE=1 SV=1
18	A8DZ03	1.19e-40	164	1161	0.188	0.134	A8DZ03_DROME Kuzbanian, isoform G OS=Drosophila melanogaster OX=7227 GN=kuz PE=1 SV=2
19	A0A8I5Y224	9.92e-24	109	852	0.166	0.161	A0A8I5Y224_RAT ADAM metallopeptidase domain 9 OS=Rattus norvegicus OX=10116 GN=Adam9 PE=1 SV=1
20	A0A8I6AAS7	1.75e-23	108	827	0.166	0.166	A0A8I6AAS7_RAT ADAM metallopeptidase domain 9 OS=Rattus norvegicus OX=10116 GN=Adam9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16698 ADAM17_MPD	2.3e-18	77.6	Membrane-proximal domain, switch, for ADAM17
2	PF00200 Disintegrin	5.5e-11	54.4	Disintegrin
3	PF01562 Pep_M12B_propep	0.00058	31.6	Reprolysin family propeptide
4	PF01421 Reprolysin	1.2e-07	43.4	Reprolysin (M12B) family zinc metalloprotease
5	PF13574 Reprolysin_2	2.3e-28	110.9	Metallo-peptidase family M12B Reprolysin-like
6	PF13582 Reprolysin_3	1.4e-09	49.9	Metallo-peptidase family M12B Reprolysin-like
7	PF13583 Reprolysin_4	0.026	25.7	Metallo-peptidase family M12B Reprolysin-like
8	PF13688 Reprolysin_5	6e-32	122.9	Metallo-peptidase family M12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309968

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266085	0.987	Metalloproteinase inhibitor 3
2	9606.ENSP00000322775	0.987	Inactive rhomboid protein 2
3	9606.ENSP00000398698	0.987	Tumor necrosis factor
4	9606.ENSP00000277541	0.978	Neurogenic locus notch homolog protein 1
5	9606.ENSP00000254958	0.969	Protein jagged-1
6	9606.ENSP00000230990	0.968	Proheparin-binding EGF-like growth factor
7	9606.ENSP00000483552	0.968	Furin
8	9606.ENSP00000265171	0.964	Pro-epidermal growth factor
9	9606.ENSP00000365435	0.964	Tumor necrosis factor receptor superfamily member 1B
10	9606.ENSP00000342235	0.959	Receptor tyrosine-protein kinase erbB-4
11	9606.ENSP00000384620	0.958	Pro-neuregulin-1, membrane-bound isoform
12	9606.ENSP00000244869	0.956	Proepiregulin
13	9606.ENSP00000379092	0.956	Probetacellulin
14	9606.ENSP00000355718	0.953	Delta-like protein 1
15	9606.ENSP00000328169	0.950	Protein jagged-2
16	9606.ENSP00000275493	0.949	Epidermal growth factor receptor
17	9606.ENSP00000269571	0.948	Receptor tyrosine-protein kinase erbB-2
18	9606.ENSP00000249749	0.947	Delta-like protein 4
19	9606.ENSP00000229795	0.929	Mitogen-activated protein kinase 14
20	9606.ENSP00000352071	0.929	Scavenger receptor cysteine-rich type 1 protein M130

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004222	1.000	metalloendopeptidase activity
GO:0008238	0.909	exopeptidase activity
GO:0008236	0.902	serine-type peptidase activity
GO:0008235	0.899	metalloexopeptidase activity
GO:0016805	0.893	dipeptidase activity
GO:0004252	0.881	serine-type endopeptidase activity
GO:0070573	0.574	metallodipeptidase activity
GO:0005102	0.303	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0048518	0.988	positive regulation of biological process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0043170	0.986	macromolecule metabolic process
GO:0009987	0.985	cellular process
GO:0048522	0.983	positive regulation of cellular process
GO:0006508	0.983	proteolysis
GO:0007165	0.968	signal transduction
GO:0044093	0.965	positive regulation of molecular function
GO:0048519	0.961	negative regulation of biological process
GO:0032502	0.959	developmental process
GO:0033619	0.954	membrane protein proteolysis
GO:0048523	0.950	negative regulation of cellular process
GO:0042221	0.949	response to chemical
GO:0032501	0.943	multicellular organismal process
GO:0043410	0.934	positive regulation of MAPK cascade
GO:0048856	0.929	anatomical structure development
GO:0019222	0.928	regulation of metabolic process
GO:0010632	0.900	regulation of epithelial cell migration
GO:0007166	0.892	cell surface receptor signaling pathway
GO:0042981	0.891	regulation of apoptotic process
GO:0042325	0.888	regulation of phosphorylation
GO:0010469	0.886	regulation of signaling receptor activity
GO:0051128	0.884	regulation of cellular component organization
GO:0051247	0.872	positive regulation of protein metabolic process
GO:0090092	0.866	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030335	0.866	positive regulation of cell migration
GO:2000273	0.865	positive regulation of signaling receptor activity
GO:0010634	0.863	positive regulation of epithelial cell migration
GO:0043085	0.850	positive regulation of catalytic activity
GO:0031399	0.840	regulation of protein modification process
GO:0006950	0.832	response to stress
GO:0007275	0.831	multicellular organism development
GO:0002376	0.829	immune system process
GO:0070372	0.821	regulation of ERK1 and ERK2 cascade
GO:0031325	0.820	positive regulation of cellular metabolic process
GO:0008284	0.809	positive regulation of cell population proliferation
GO:0002684	0.808	positive regulation of immune system process
GO:0043069	0.808	negative regulation of programmed cell death
GO:0009628	0.806	response to abiotic stimulus
GO:0001775	0.801	cell activation
GO:0016477	0.796	cell migration
GO:0050920	0.783	regulation of chemotaxis
GO:0070374	0.783	positive regulation of ERK1 and ERK2 cascade
GO:0010468	0.777	regulation of gene expression
GO:0010467	0.774	gene expression
GO:0002687	0.768	positive regulation of leukocyte migration
GO:0090287	0.761	regulation of cellular response to growth factor stimulus
GO:0071675	0.750	regulation of mononuclear cell migration
GO:0010033	0.728	response to organic substance
GO:2000401	0.726	regulation of lymphocyte migration
GO:0051604	0.708	protein maturation
GO:0048731	0.706	system development
GO:1903844	0.705	regulation of cellular response to transforming growth factor beta stimulus
GO:0048585	0.704	negative regulation of response to stimulus
GO:0071677	0.692	positive regulation of mononuclear cell migration
GO:0036293	0.689	response to decreased oxygen levels
GO:0032504	0.687	multicellular organism reproduction
GO:0030154	0.686	cell differentiation
GO:2000403	0.682	positive regulation of lymphocyte migration
GO:0050793	0.676	regulation of developmental process
GO:0009888	0.672	tissue development
GO:0016485	0.667	protein processing
GO:0080134	0.666	regulation of response to stress
GO:0010942	0.662	positive regulation of cell death
GO:0043065	0.649	positive regulation of apoptotic process
GO:0017015	0.639	regulation of transforming growth factor beta receptor signaling pathway
GO:0009653	0.638	anatomical structure morphogenesis
GO:0009892	0.611	negative regulation of metabolic process
GO:0003006	0.610	developmental process involved in reproduction
GO:0060429	0.587	epithelium development
GO:0048513	0.586	animal organ development
GO:0048468	0.585	cell development
GO:0045321	0.554	leukocyte activation
GO:0120035	0.477	regulation of plasma membrane bounded cell projection organization
GO:0010975	0.461	regulation of neuron projection development
GO:0070887	0.455	cellular response to chemical stimulus
GO:0006952	0.453	defense response
GO:0071840	0.442	cellular component organization or biogenesis
GO:0080135	0.441	regulation of cellular response to stress
GO:0120161	0.417	regulation of cold-induced thermogenesis
GO:0051240	0.416	positive regulation of multicellular organismal process
GO:0009889	0.406	regulation of biosynthetic process
GO:0071310	0.398	cellular response to organic substance
GO:0030097	0.397	hemopoiesis
GO:0002521	0.388	leukocyte differentiation
GO:0019219	0.373	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.370	regulation of macromolecule biosynthetic process
GO:0016043	0.364	cellular component organization
GO:0001666	0.340	response to hypoxia
GO:0031326	0.331	regulation of cellular biosynthetic process
GO:0090100	0.313	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0044237	0.312	cellular metabolic process
GO:0051252	0.311	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005829	0.991	cytosol
GO:0005576	0.945	extracellular region
GO:0012505	0.886	endomembrane system
GO:0009986	0.861	cell surface
GO:0031982	0.798	vesicle
GO:0031410	0.666	cytoplasmic vesicle
GO:0043233	0.432	organelle lumen
GO:0005615	0.421	extracellular space
GO:0070013	0.411	intracellular organelle lumen
GO:0045177	0.335	apical part of cell
GO:0031981	0.313	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.
EC:3.4.13.-	0.893	Dipeptidases.
EC:3.4.21.-	0.881	Serine endopeptidases.

[back to server]