StarFunc result for job id P78543

User Input

>input (158 residues)
MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPS
KGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSIC
VLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27049	0.822	0.822	1.373E-27	158	0.924	0.924	P27049.pdb.gz	BTG2_RAT Protein BTG2 OS=Rattus norvegicus OX=10116 GN=Btg2 PE=1 SV=1
2	AFDB:P62324	0.771	0.713	2.782E-22	171	0.652	0.602	P62324.pdb.gz	BTG1_HUMAN Protein BTG1 OS=Homo sapiens OX=9606 GN=BTG1 PE=1 SV=1
3	AFDB:Q61471	0.709	0.319	1.880E-14	362	0.335	0.146	Q61471.pdb.gz	TOB1_MOUSE Protein Tob1 OS=Mus musculus OX=10090 GN=Tob1 PE=1 SV=2
4	AFDB:Q14106	0.700	0.331	3.857E-14	344	0.329	0.151	Q14106.pdb.gz	TOB2_HUMAN Protein Tob2 OS=Homo sapiens OX=9606 GN=TOB2 PE=1 SV=2
5	AFDB:Q9JM55	0.708	0.332	7.021E-14	345	0.348	0.159	Q9JM55.pdb.gz	TOB2_MOUSE Protein Tob2 OS=Mus musculus OX=10090 GN=Tob2 PE=2 SV=1
6	PDB:5ci8A	0.697	0.931	1.199E-13	117	0.310	0.419	5ci8A.pdb.gz	Structural basis for inhibition of the Tob-CNOT7 interaction by a fragment screening approach
7	AFDB:Q7SZR1	0.689	0.345	1.724E-13	322	0.316	0.155	Q7SZR1.pdb.gz	Q7SZR1_DANRE Protein Tob1 OS=Danio rerio OX=7955 GN=tob1 PE=2 SV=1
8	AFDB:O70552	0.676	0.434	5.380E-13	250	0.316	0.200	O70552.pdb.gz	BTG4_MOUSE Protein BTG4 OS=Mus musculus OX=10090 GN=Btg4 PE=1 SV=2
9	AFDB:Q9NY30	0.671	0.481	3.658E-12	223	0.272	0.193	Q9NY30.pdb.gz	BTG4_HUMAN Protein BTG4 OS=Homo sapiens OX=9606 GN=BTG4 PE=1 SV=1
10	AFDB:Q9VXJ9	0.676	0.196	4.378E-12	564	0.348	0.098	Q9VXJ9.pdb.gz	Q9VXJ9_DROME Transducer of ERBB2, isoform A OS=Drosophila melanogaster OX=7227 GN=Tob PE=3 SV=1
11	AFDB:O88677	0.687	0.438	4.935E-12	252	0.310	0.194	O88677.pdb.gz	BTG3_RAT Protein BTG3 OS=Rattus norvegicus OX=10116 GN=Btg3 PE=2 SV=1
12	PDB:6pedB	0.139	0.157	7.531E-1	126	0.108	0.135	6pedB.pdb.gz	Crystal structure of HEMK2-TRMT112 complex
13	PDB:4v1nM	0.284	0.168	1.016	299	0.076	0.040	4v1nM.pdb.gz	Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.
14	PDB:7ml4M	0.299	0.216	1.455	234	0.082	0.056	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
15	PDB:2we6A	0.176	0.156	1.545	208	0.044	0.034	2we6A.pdb.gz
16	PDB:3fd5B	0.176	0.100	1.545	355	0.095	0.042	3fd5B.pdb.gz	Crystal structures of catalytic intermediates of human selenophosphate synthetase 1.
17	PDB:6fhsC	0.123	0.054	1.742	459	0.051	0.017	6fhsC.pdb.gz	Structural basis for ATP-dependent chromatin remodelling by the INO80 complex.
18	PDB:6u9fB	0.091	0.102	1.742	133	0.057	0.068	6u9fB.pdb.gz
19	PDB:3v6iA	0.138	0.127	1.849	187	0.127	0.107	3v6iA.pdb.gz	The dynamic stator stalk of rotary ATPases
20	PDB:6pzkA	0.173	0.035	1.849	1361	0.108	0.012	6pzkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78543	2.47e-116	327	158	1.000	1.000	BTG2_HUMAN Protein BTG2 OS=Homo sapiens OX=9606 GN=BTG2 PE=1 SV=1
2	Q04211	3.12e-109	309	158	0.937	0.937	BTG2_MOUSE Protein BTG2 OS=Mus musculus OX=10090 GN=Btg2 PE=1 SV=1
3	P27049	1.34e-108	307	158	0.924	0.924	BTG2_RAT Protein BTG2 OS=Rattus norvegicus OX=10116 GN=Btg2 PE=1 SV=1
4	P62324	2.89e-72	216	171	0.652	0.602	BTG1_HUMAN Protein BTG1 OS=Homo sapiens OX=9606 GN=BTG1 PE=1 SV=1
5	P62325	2.89e-72	216	171	0.652	0.602	BTG1_MOUSE Protein BTG1 OS=Mus musculus OX=10090 GN=Btg1 PE=1 SV=1
6	Q6IBC8	2.89e-72	216	171	0.652	0.602	Q6IBC8_HUMAN B-cell translocation gene 1, anti-proliferative OS=Homo sapiens OX=9606 GN=BTG1 PE=1 SV=1
7	Q63073	4.14e-72	216	171	0.652	0.602	BTG1_RAT Protein BTG1 OS=Rattus norvegicus OX=10116 GN=Btg1 PE=2 SV=1
8	Q7SZR1	3.59e-29	110	322	0.291	0.143	Q7SZR1_DANRE Protein Tob1 OS=Danio rerio OX=7955 GN=tob1 PE=2 SV=1
9	P50616	4.26e-29	110	345	0.316	0.145	TOB1_HUMAN Protein Tob1 OS=Homo sapiens OX=9606 GN=TOB1 PE=1 SV=1
10	Q61471	6.59e-29	110	362	0.310	0.135	TOB1_MOUSE Protein Tob1 OS=Mus musculus OX=10090 GN=Tob1 PE=1 SV=2
11	Q14106	1.18e-26	104	344	0.291	0.134	TOB2_HUMAN Protein Tob2 OS=Homo sapiens OX=9606 GN=TOB2 PE=1 SV=2
12	Q9JM55	3.49e-26	103	345	0.291	0.133	TOB2_MOUSE Protein Tob2 OS=Mus musculus OX=10090 GN=Tob2 PE=2 SV=1
13	Q9VXJ9	5.36e-26	104	564	0.285	0.080	Q9VXJ9_DROME Transducer of ERBB2, isoform A OS=Drosophila melanogaster OX=7227 GN=Tob PE=3 SV=1
14	O70552	1.01e-22	92.4	250	0.291	0.184	BTG4_MOUSE Protein BTG4 OS=Mus musculus OX=10090 GN=Btg4 PE=1 SV=2
15	P50615	1.71e-22	91.7	252	0.304	0.190	BTG3_MOUSE Protein BTG3 OS=Mus musculus OX=10090 GN=Btg3 PE=2 SV=1
16	O88677	7.62e-22	90.1	252	0.297	0.187	BTG3_RAT Protein BTG3 OS=Rattus norvegicus OX=10116 GN=Btg3 PE=2 SV=1
17	Q14201	8.93e-22	89.7	252	0.304	0.190	BTG3_HUMAN Protein BTG3 OS=Homo sapiens OX=9606 GN=BTG3 PE=1 SV=3
18	Q9NY30	2.09e-21	88.2	223	0.297	0.211	BTG4_HUMAN Protein BTG4 OS=Homo sapiens OX=9606 GN=BTG4 PE=1 SV=1
19	Q54NU5	3.49e-11	62.4	423	0.209	0.078	BTG_DICDI BTG family protein OS=Dictyostelium discoideum OX=44689 GN=btg PE=3 SV=1
20	G5EDX7	0.004	38.5	263	0.165	0.099	G5EDX7_CAEEL Anti-proliferative protein domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fog-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07742 BTG	7.7e-40	146.6	BTG family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290551

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000406162	0.999	Protein arginine N-methyltransferase 1
2	9606.ENSP00000309439	0.987	Homeobox protein Hox-B9
3	9606.ENSP00000355279	0.976	CCR4-NOT transcription complex subunit 7
4	9606.ENSP00000269305	0.955	Cellular tumor antigen p53
5	9606.ENSP00000227507	0.943	G1/S-specific cyclin-D1
6	9606.ENSP00000306245	0.917	Proto-oncogene c-Fos
7	9606.ENSP00000344352	0.914	Cyclic AMP-dependent transcription factor ATF-3
8	9606.ENSP00000430493	0.908	CCR4-NOT transcription complex subunit 8
9	9606.ENSP00000301280	0.901	Chromatin assembly factor 1 subunit A
10	9606.ENSP00000315700	0.900	Chromatin assembly factor 1 subunit B
11	9606.ENSP00000239223	0.864	Dual specificity protein phosphatase 1
12	9606.ENSP00000313007	0.846	Polyadenylate-binding protein 1
13	9606.ENSP00000440864	0.823	Nuclear receptor subfamily 4 group A member 1
14	9606.ENSP00000360266	0.813	Transcription factor AP-1
15	9606.ENSP00000465617	0.810	Immediate early response gene 2 protein
16	9606.ENSP00000239938	0.799	Early growth response protein 1
17	9606.ENSP00000419923	0.782	Krueppel-like factor 6
18	9606.ENSP00000362649	0.769	Histone deacetylase 1
19	9606.ENSP00000273064	0.765	CCR4-NOT transcription complex subunit 9
20	9606.ENSP00000424896	0.755	CCR4-NOT transcription complex subunit 6-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.452	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.985	response to stimulus
GO:0007399	0.985	nervous system development
GO:0071704	0.979	organic substance metabolic process
GO:0048518	0.974	positive regulation of biological process
GO:0044237	0.974	cellular metabolic process
GO:0044238	0.971	primary metabolic process
GO:0043170	0.969	macromolecule metabolic process
GO:0019222	0.966	regulation of metabolic process
GO:0048523	0.963	negative regulation of cellular process
GO:0006807	0.958	nitrogen compound metabolic process
GO:0060255	0.957	regulation of macromolecule metabolic process
GO:0042127	0.957	regulation of cell population proliferation
GO:0010468	0.937	regulation of gene expression
GO:0044260	0.887	cellular macromolecule metabolic process
GO:0048522	0.819	positive regulation of cellular process
GO:0022008	0.819	neurogenesis
GO:0009893	0.805	positive regulation of metabolic process
GO:0031327	0.797	negative regulation of cellular biosynthetic process
GO:0010604	0.769	positive regulation of macromolecule metabolic process
GO:0010558	0.765	negative regulation of macromolecule biosynthetic process
GO:0080090	0.760	regulation of primary metabolic process
GO:0051172	0.760	negative regulation of nitrogen compound metabolic process
GO:0006950	0.736	response to stress
GO:0019219	0.725	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.720	regulation of RNA metabolic process
GO:0051716	0.704	cellular response to stimulus
GO:0042221	0.703	response to chemical
GO:0008285	0.685	negative regulation of cell population proliferation
GO:0048699	0.665	generation of neurons
GO:0051173	0.640	positive regulation of nitrogen compound metabolic process
GO:0031325	0.640	positive regulation of cellular metabolic process
GO:0010941	0.639	regulation of cell death
GO:0006355	0.626	regulation of DNA-templated transcription
GO:0010033	0.579	response to organic substance
GO:0009719	0.576	response to endogenous stimulus
GO:0048468	0.552	cell development
GO:0051254	0.546	positive regulation of RNA metabolic process
GO:0030182	0.525	neuron differentiation
GO:0006357	0.486	regulation of transcription by RNA polymerase II
GO:0042981	0.454	regulation of apoptotic process
GO:1901360	0.413	organic cyclic compound metabolic process
GO:0034641	0.408	cellular nitrogen compound metabolic process
GO:0046483	0.390	heterocycle metabolic process
GO:0006725	0.390	cellular aromatic compound metabolic process
GO:1901698	0.370	response to nitrogen compound
GO:0051246	0.326	regulation of protein metabolic process
GO:0051253	0.320	negative regulation of RNA metabolic process
GO:1901700	0.316	response to oxygen-containing compound
GO:0071840	0.303	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0005829	0.990	cytosol
GO:0005634	0.969	nucleus
GO:0005654	0.958	nucleoplasm
GO:0005576	0.732	extracellular region
GO:0031982	0.640	vesicle
GO:0005615	0.588	extracellular space
GO:0065010	0.574	extracellular membrane-bounded organelle
GO:1903561	0.555	extracellular vesicle
GO:0070062	0.549	extracellular exosome
GO:0032991	0.336	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]