StarFunc result for job id P78545

User Input

>input (371 residues)
MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWL
GEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQ
LHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYH
PGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDP
KHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHE
GVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSG
WKEEEVLQSRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R974	0.685	0.685	6.668E-54	371	1.000	1.000	A0A024R974.pdb.gz
2	AFDB:Q9NZC4	0.383	0.459	7.498E-23	300	0.337	0.417	Q9NZC4.pdb.gz	EHF_HUMAN ETS homologous factor OS=Homo sapiens OX=9606 GN=EHF PE=2 SV=1
3	AFDB:A2RV31	0.248	0.237	6.384E-14	391	0.216	0.205	A2RV31.pdb.gz	A2RV31_DANRE Transcription factor ETV7 OS=Danio rerio OX=7955 GN=zgc:158758 PE=2 SV=1
4	AFDB:A8WFJ9	0.236	0.201	2.343E-12	437	0.208	0.176	A8WFJ9.pdb.gz	ETS4_CAEEL Transcription factor ets-4 OS=Caenorhabditis elegans OX=6239 GN=ets-4 PE=1 SV=1
5	AFDB:B2GTA2	0.230	0.193	6.715E-12	444	0.243	0.203	B2GTA2.pdb.gz
6	AFDB:Q5PR65	0.230	0.201	2.684E-11	427	0.194	0.169	Q5PR65.pdb.gz	Q5PR65_DANRE Erg protein OS=Danio rerio OX=7955 GN=zgc:103429 PE=2 SV=1
7	AFDB:P97360	0.222	0.172	2.837E-11	485	0.213	0.163	P97360.pdb.gz	ETV6_MOUSE Transcription factor ETV6 OS=Mus musculus OX=10090 GN=Etv6 PE=1 SV=1
8	AFDB:P15036	0.212	0.169	3.956E-11	469	0.229	0.181	P15036.pdb.gz	ETS2_HUMAN Protein C-ets-2 OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
9	AFDB:A0A0S2Z3C9	0.232	0.192	1.015E-10	452	0.221	0.181	A0A0S2Z3C9.pdb.gz	A0A0S2Z3C9_HUMAN Ets variant 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ETV6 PE=2 SV=1
10	AFDB:P10157	0.212	0.165	2.604E-10	479	0.213	0.165	P10157.pdb.gz	ETS2_CHICK Protein C-ets-2 OS=Gallus gallus OX=9031 GN=ETS2 PE=2 SV=1
11	PDB:4byyA	0.148	0.220	5.080E-1	226	0.046	0.075	4byyA.pdb.gz
12	PDB:3i54D	0.137	0.196	5.999E-1	228	0.032	0.053	3i54D.pdb.gz	Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
13	PDB:7ctfA	0.174	0.478	8.843E-1	102	0.043	0.157	7ctfA.pdb.gz	Structural insight into the assembly and conformational activation of human origin recognition complex.
14	PDB:3m8eA	0.124	0.350	1.104	101	0.035	0.129	3m8eA.pdb.gz
15	PDB:7ff0A	0.148	0.240	1.167	206	0.022	0.039	7ff0A.pdb.gz	Inhibitory mechanism of gold analogues against Pseudomonas global virulence factor regulator Vfr
16	PDB:1u5tA	0.126	0.192	1.233	213	0.030	0.052	1u5tA.pdb.gz
17	PDB:7qp6a	0.116	0.351	1.233	99	0.040	0.152	7qp6a.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
18	PDB:3cuqC	0.146	0.273	1.539	173	0.027	0.058	3cuqC.pdb.gz
19	PDB:7pzyL	0.108	0.296	1.539	93	0.022	0.086	7pzyL.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
20	PDB:1jhfA	0.144	0.245	1.627	197	0.032	0.061	1jhfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78545	0.0	769	371	1.000	1.000	ELF3_HUMAN ETS-related transcription factor Elf-3 OS=Homo sapiens OX=9606 GN=ELF3 PE=1 SV=1
2	Q3UPW2	0.0	658	391	0.876	0.831	ELF3_MOUSE ETS-related transcription factor Elf-3 OS=Mus musculus OX=10090 GN=Elf3 PE=1 SV=1
3	Q5SR36	1.49e-167	469	232	0.625	1.000	Q5SR36_HUMAN E74 like ETS transcription factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=ELF3 PE=1 SV=1
4	Q9NZC4	8.43e-53	179	300	0.218	0.270	EHF_HUMAN ETS homologous factor OS=Homo sapiens OX=9606 GN=EHF PE=2 SV=1
5	Q8VDK3	2.44e-39	142	253	0.167	0.245	ELF5_MOUSE ETS-related transcription factor Elf-5 OS=Mus musculus OX=10090 GN=Elf5 PE=2 SV=2
6	Q9UKW6	1.12e-38	140	265	0.164	0.230	ELF5_HUMAN ETS-related transcription factor Elf-5 OS=Homo sapiens OX=9606 GN=ELF5 PE=1 SV=2
7	G3V9V2	1.05e-21	99.0	615	0.132	0.080	G3V9V2_RAT E74 like ETS transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=3 SV=1
8	Q9EQY3	1.79e-21	98.2	615	0.132	0.080	Q9EQY3_RAT Ets-family transcription factor ELF1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=2 SV=1
9	P20105	2.13e-21	98.2	829	0.113	0.051	E74EA_DROME Ecdysone-induced protein 74EF isoform A OS=Drosophila melanogaster OX=7227 GN=Eip74EF PE=2 SV=2
10	Q9JHC9	3.24e-21	97.4	593	0.127	0.079	ELF2_MOUSE ETS-related transcription factor Elf-2 OS=Mus musculus OX=10090 GN=Elf2 PE=1 SV=1
11	A8WFJ9	4.01e-21	96.3	437	0.202	0.172	ETS4_CAEEL Transcription factor ets-4 OS=Caenorhabditis elegans OX=6239 GN=ets-4 PE=1 SV=1
12	H2KYY1	5.65e-21	95.9	420	0.113	0.100	H2KYY1_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elf-1 PE=3 SV=1
13	P11536	6.65e-21	96.7	883	0.113	0.048	E74EB_DROME Ecdysone-induced protein 74EF isoform B OS=Drosophila melanogaster OX=7227 GN=Eip74EF PE=2 SV=2
14	Q15723	9.48e-21	95.9	593	0.127	0.079	ELF2_HUMAN ETS-related transcription factor Elf-2 OS=Homo sapiens OX=9606 GN=ELF2 PE=1 SV=2
15	B7Z720	1.04e-20	95.5	521	0.127	0.090	B7Z720_HUMAN E74-like factor 2 (Ets domain transcription factor), isoform CRA_b OS=Homo sapiens OX=9606 GN=ELF2 PE=2 SV=1
16	Q400M2	1.19e-20	94.7	419	0.113	0.100	Q400M2_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elf-1 PE=3 SV=2
17	Q9Z2U4	5.14e-20	94.0	655	0.135	0.076	ELF4_MOUSE ETS-related transcription factor Elf-4 OS=Mus musculus OX=10090 GN=Elf4 PE=1 SV=2
18	Q99607	1.02e-19	92.8	663	0.113	0.063	ELF4_HUMAN ETS-related transcription factor Elf-4 OS=Homo sapiens OX=9606 GN=ELF4 PE=1 SV=1
19	P32519	1.49e-19	92.4	619	0.127	0.076	ELF1_HUMAN ETS-related transcription factor Elf-1 OS=Homo sapiens OX=9606 GN=ELF1 PE=1 SV=2
20	Q60775	3.84e-19	91.3	612	0.100	0.060	ELF1_MOUSE ETS-related transcription factor Elf-1 OS=Mus musculus OX=10090 GN=Elf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02178 AT_hook	5.1e+02	12.0	AT hook motif
2	PF00178 Ets	2.2e-27	106.5	Ets-domain
3	PF02198 SAM_PNT	3.5e-21	86.3	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352673

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357047	0.989	Mediator of RNA polymerase II transcription subunit 23
2	9606.ENSP00000295797	0.938	Protein kinase C iota type
3	9606.ENSP00000361669	0.821	Homeobox protein ESX1
4	9606.ENSP00000260264	0.733	POU domain, class 2, transcription factor 3
5	9606.ENSP00000376423	0.727	Small proline-rich protein 2A
6	9606.ENSP00000405330	0.715	Estrogen receptor
7	9606.ENSP00000349259	0.646	Spectrin beta chain, non-erythrocytic 1
8	9606.ENSP00000351671	0.636	C-C motif chemokine 20
9	9606.ENSP00000262367	0.610	CREB-binding protein
10	9606.ENSP00000391490	0.592	Anterior gradient protein 2 homolog
11	9606.ENSP00000359206	0.570	F-box/WD repeat-containing protein 1A
12	9606.ENSP00000384273	0.555	Transcription factor p65
13	9606.ENSP00000365806	0.553	Guanine nucleotide-binding protein-like 1
14	9606.ENSP00000360798	0.551	Epidermal growth factor receptor substrate 15
15	9606.ENSP00000269571	0.548	Receptor tyrosine-protein kinase erbB-2
16	9606.ENSP00000442682	0.547	Arf-GAP with dual PH domain-containing protein 1
17	9606.ENSP00000365210	0.542	G2/mitotic-specific cyclin-B3
18	9606.ENSP00000265343	0.528	AF4/FMR2 family member 4
19	9606.ENSP00000369344	0.522	Probable G-protein coupled receptor 150
20	9606.ENSP00000263253	0.518	Histone acetyltransferase p300

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0005515	0.997	protein binding
GO:0000977	0.996	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.989	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0010468	0.994	regulation of gene expression
GO:0048522	0.986	positive regulation of cellular process
GO:0010556	0.986	regulation of macromolecule biosynthetic process
GO:0031326	0.986	regulation of cellular biosynthetic process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0048519	0.983	negative regulation of biological process
GO:0010604	0.979	positive regulation of macromolecule metabolic process
GO:0006357	0.977	regulation of transcription by RNA polymerase II
GO:0051173	0.959	positive regulation of nitrogen compound metabolic process
GO:0050896	0.955	response to stimulus
GO:0031325	0.947	positive regulation of cellular metabolic process
GO:0048523	0.937	negative regulation of cellular process
GO:0009987	0.928	cellular process
GO:0045944	0.919	positive regulation of transcription by RNA polymerase II
GO:0009892	0.760	negative regulation of metabolic process
GO:0006950	0.758	response to stress
GO:0010605	0.745	negative regulation of macromolecule metabolic process
GO:0051172	0.738	negative regulation of nitrogen compound metabolic process
GO:0045934	0.729	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.726	negative regulation of biosynthetic process
GO:0051253	0.724	negative regulation of RNA metabolic process
GO:0045892	0.702	negative regulation of DNA-templated transcription
GO:0032502	0.672	developmental process
GO:0048856	0.639	anatomical structure development
GO:0032501	0.398	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol
GO:0012505	0.994	endomembrane system
GO:0005794	0.683	Golgi apparatus
GO:0016020	0.448	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]