StarFunc result for job id P78549

User Input

>input (312 residues)
MCSPQESGMTALSARMLTRSRSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRK
AQRLRVAYEGSDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYD
SSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVG
FWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDT
HVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVHPRCHAC
LNQALCPAAQGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78549	1.000	1.000	1.413E-44	312	1.000	1.000	P78549.pdb.gz	NTH_HUMAN Endonuclease III-like protein 1 OS=Homo sapiens OX=9606 GN=NTHL1 PE=1 SV=2
2	AFDB:O35980	0.811	0.843	4.349E-38	300	0.776	0.807	O35980.pdb.gz	NTH_MOUSE Endonuclease III-like protein 1 OS=Mus musculus OX=10090 GN=Nthl1 PE=2 SV=2
3	AFDB:P54137	0.694	0.726	6.885E-21	298	0.362	0.379	P54137.pdb.gz	NTH_CAEEL Endonuclease III homolog OS=Caenorhabditis elegans OX=6239 GN=nth-1 PE=1 SV=2
4	AFDB:B9DFZ0	0.705	0.575	1.210E-20	386	0.394	0.319	B9DFZ0.pdb.gz	NTH2_ARATH Endonuclease III homolog 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NTH2 PE=2 SV=1
5	AFDB:Q09907	0.697	0.615	1.761E-19	355	0.343	0.301	Q09907.pdb.gz	NTH_SCHPO Endonuclease III homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nth1 PE=1 SV=1
6	AFDB:P31378	0.636	0.500	4.717E-17	399	0.333	0.261	P31378.pdb.gz	NTH1_YEAST Endonuclease III homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTG1 PE=1 SV=1
7	AFDB:Q08214	0.670	0.553	1.841E-15	380	0.317	0.261	Q08214.pdb.gz	NTH2_YEAST Endonuclease III homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTG2 PE=1 SV=1
8	PDB:2abkA	0.555	0.792	1.890E-11	211	0.189	0.280	2abkA.pdb.gz	Novel DNA binding motifs in the DNA repair enzyme endonuclease III crystal structure.
9	AFDB:P0AB83	0.570	0.822	2.435E-11	211	0.189	0.280	P0AB83.pdb.gz	END3_ECOLI Endonuclease III OS=Escherichia coli (strain K12) OX=83333 GN=nth PE=1 SV=1
10	AFDB:P9WQ11	0.545	0.686	9.966E-11	245	0.205	0.261	P9WQ11.pdb.gz	END3_MYCTU Endonuclease III OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nth PE=1 SV=1
11	AFDB:A0A0H2UQJ4	0.565	0.826	1.521E-10	209	0.176	0.263	A0A0H2UQJ4.pdb.gz	A0A0H2UQJ4_STRPN Endonuclease III OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=nth PE=1 SV=1
12	PDB:4yprA	0.547	0.486	5.559E-8	355	0.154	0.135	4yprA.pdb.gz	Structural Basis for Avoidance of Promutagenic DNA Repair by MutY Adenine DNA Glycosylase.
13	PDB:2xhiA	0.410	0.405	1.122E-3	316	0.119	0.117	2xhiA.pdb.gz	Separation-of-Function Mutants Unravel the Dual- Reaction Mode of Human 8-Oxoguanine DNA Glycosylase.
14	PDB:6g3yA	0.400	0.395	1.122E-3	316	0.141	0.139	6g3yA.pdb.gz	Small-molecule inhibitor of OGG1 suppresses proinflammatory gene expression and inflammation.
15	PDB:4b21A	0.398	0.570	1.795E-3	207	0.103	0.155	4b21A.pdb.gz	Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
16	PDB:3ogdA	0.381	0.408	1.881E-3	288	0.096	0.104	3ogdA.pdb.gz	Structure of Escherichia coli AlkA in Complex with Undamaged DNA.
17	PDB:3s6iD	0.388	0.553	9.286E-2	207	0.093	0.140	3s6iD.pdb.gz	Analysis of substrate specificity of Schizosaccharomyces pombe Mag1 alkylpurine DNA glycosylase.
18	PDB:1itfA	0.109	0.160	6.680E-1	165	0.093	0.176	1itfA.pdb.gz
19	PDB:2pk9D	0.126	0.161	6.680E-1	219	0.087	0.123	2pk9D.pdb.gz
20	PDB:6k5vA	0.110	0.087	7.001E-1	433	0.083	0.060	6k5vA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78549	0.0	640	312	1.000	1.000	NTH_HUMAN Endonuclease III-like protein 1 OS=Homo sapiens OX=9606 GN=NTHL1 PE=1 SV=2
2	O35980	5.70e-180	500	300	0.776	0.807	NTH_MOUSE Endonuclease III-like protein 1 OS=Mus musculus OX=10090 GN=Nthl1 PE=2 SV=2
3	Q9SIC4	6.55e-79	246	379	0.388	0.319	NTH1_ARATH Endonuclease III homolog 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NTH1 PE=2 SV=2
4	P54137	8.49e-73	228	298	0.356	0.372	NTH_CAEEL Endonuclease III homolog OS=Caenorhabditis elegans OX=6239 GN=nth-1 PE=1 SV=2
5	B9DFZ0	1.42e-71	228	386	0.378	0.306	NTH2_ARATH Endonuclease III homolog 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NTH2 PE=2 SV=1
6	Q09907	5.11e-64	207	355	0.343	0.301	NTH_SCHPO Endonuclease III homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nth1 PE=1 SV=1
7	P31378	9.12e-53	179	399	0.308	0.241	NTH1_YEAST Endonuclease III homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTG1 PE=1 SV=1
8	Q08214	6.63e-48	166	380	0.282	0.232	NTH2_YEAST Endonuclease III homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTG2 PE=1 SV=1
9	P9WQ11	1.98e-23	98.6	245	0.183	0.233	END3_MYCTU Endonuclease III OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nth PE=1 SV=1
10	P0AB83	9.79e-22	93.2	211	0.176	0.261	END3_ECOLI Endonuclease III OS=Escherichia coli (strain K12) OX=83333 GN=nth PE=1 SV=1
11	A0A0H2UQJ4	2.39e-20	89.4	209	0.167	0.249	A0A0H2UQJ4_STRPN Endonuclease III OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=nth PE=1 SV=1
12	P83847	1.13e-11	67.0	366	0.163	0.139	MUTY_GEOSE Adenine DNA glycosylase OS=Geobacillus stearothermophilus OX=1422 GN=mutY PE=1 SV=2
13	Q9A623	2.55e-08	55.8	241	0.160	0.207	Q9A623_CAUVC Endonuclease III family protein OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=CC_2272 PE=4 SV=1
14	Q10159	1.73e-06	51.6	461	0.176	0.119	MYH1_SCHPO Adenine DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=myh1 PE=1 SV=1
15	Q8R5G2	8.53e-05	46.2	516	0.147	0.089	MUTYH_RAT Adenine DNA glycosylase OS=Rattus norvegicus OX=10116 GN=Mutyh PE=2 SV=1
16	Q99P21	9.49e-05	46.2	515	0.167	0.101	MUTYH_MOUSE Adenine DNA glycosylase OS=Mus musculus OX=10090 GN=Mutyh PE=1 SV=2
17	E9PM53	1.78e-04	45.4	535	0.144	0.084	E9PM53_HUMAN Adenine DNA glycosylase OS=Homo sapiens OX=9606 GN=MUTYH PE=1 SV=2
18	E5KP26	1.89e-04	45.4	546	0.144	0.082	E5KP26_HUMAN Adenine DNA glycosylase OS=Homo sapiens OX=9606 GN=MUTYH PE=3 SV=1
19	Q9UIF7	1.89e-04	45.4	546	0.144	0.082	MUTYH_HUMAN Adenine DNA glycosylase OS=Homo sapiens OX=9606 GN=MUTYH PE=1 SV=1
20	A0A5F9ZI14	1.93e-04	45.1	466	0.144	0.097	A0A5F9ZI14_HUMAN Adenine DNA glycosylase (Fragment) OS=Homo sapiens OX=9606 GN=MUTYH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00633 HHH	9.7e-06	36.3	Helix-hairpin-helix motif
2	PF00730 HhH-GPD	3e-21	87.2	HhH-GPD superfamily base excision DNA repair protein
3	PF12836 HHH_3	6e+02	12.1	Helix-hairpin-helix motif
4	PF14520 HHH_5	6e+02	12.4	Helix-hairpin-helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219066

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216714	0.995	DNA-(apurinic or apyrimidinic site) lyase
2	9606.ENSP00000306561	0.962	N-glycosylase/DNA lyase
3	9606.ENSP00000361170	0.921	Adenine DNA glycosylase
4	9606.ENSP00000347170	0.911	Endonuclease 8-like 1
5	9606.ENSP00000364126	0.908	DNA-(apurinic or apyrimidinic site) lyase 2
6	9606.ENSP00000242576	0.900	Uracil-DNA glycosylase
7	9606.ENSP00000305480	0.899	Flap endonuclease 1
8	9606.ENSP00000264596	0.882	Endonuclease 8-like 3
9	9606.ENSP00000284503	0.874	Endonuclease 8-like 2
10	9606.ENSP00000371475	0.854	TP53-binding protein 1
11	9606.ENSP00000325863	0.845	Double-strand break repair protein MRE11
12	9606.ENSP00000364270	0.838	DNA repair protein complementing XP-A cells
13	9606.ENSP00000400806	0.833	Aprataxin
14	9606.ENSP00000347978	0.832	DNA repair protein complementing XP-G cells
15	9606.ENSP00000361626	0.825	Nuclease-sensitive element-binding protein 1
16	9606.ENSP00000231790	0.805	DNA mismatch repair protein Mlh1
17	9606.ENSP00000323511	0.793	Bifunctional polynucleotide phosphatase/kinase
18	9606.ENSP00000219431	0.791	DNA-3-methyladenine glycosylase
19	9606.ENSP00000263274	0.791	DNA ligase 1
20	9606.ENSP00000262887	0.787	DNA repair protein XRCC1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003906	1.000	DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0005515	0.999	protein binding
GO:0004518	0.999	nuclease activity
GO:0003684	0.999	damaged DNA binding
GO:0000702	0.999	oxidized base lesion DNA N-glycosylase activity
GO:0016835	0.995	carbon-oxygen lyase activity
GO:0003690	0.933	double-stranded DNA binding
GO:0004519	0.914	endonuclease activity
GO:0000703	0.869	oxidized pyrimidine nucleobase lesion DNA N-glycosylase activity
GO:0008534	0.665	oxidized purine nucleobase lesion DNA N-glycosylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0050896	0.995	response to stimulus
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0006281	0.988	DNA repair
GO:1901564	0.957	organonitrogen compound metabolic process
GO:0034655	0.956	nucleobase-containing compound catabolic process
GO:0006289	0.950	nucleotide-excision repair
GO:0006284	0.934	base-excision repair
GO:0006220	0.915	pyrimidine nucleotide metabolic process
GO:0009219	0.913	pyrimidine deoxyribonucleotide metabolic process
GO:0072529	0.912	pyrimidine-containing compound catabolic process
GO:0009166	0.911	nucleotide catabolic process
GO:1901136	0.906	carbohydrate derivative catabolic process
GO:0006304	0.902	DNA modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.890	cytoplasm
GO:0005739	0.313	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.2.-	1.000	Hydrolyzing N-glycosyl compounds.
EC:3.1.-.-	0.999	Acting on ester bonds.
EC:4.2.-.-	0.995	Carbon-oxygen lyases.
EC:3.2.2.23	0.665	DNA-formamidopyrimidine glycosylase.

[back to server]