StarFunc result for job id P78552

User Input

>input (427 residues)
MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASS
NCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISP
PEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREG
QYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHN
DDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAKCENPEFERNVENTSCFMVP
GVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNSTLYITMLLIVPVIVAGAI
IVLLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIE
NLKKASQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78552	1.000	1.000	4.463E-75	427	1.000	1.000	P78552.pdb.gz	I13R1_HUMAN Interleukin-13 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL13RA1 PE=1 SV=1
2	AFDB:Q561K3	0.747	0.749	1.359E-55	426	0.721	0.723	Q561K3.pdb.gz	Q561K3_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
3	AFDB:Q01344	0.612	0.621	9.719E-24	420	0.208	0.212	Q01344.pdb.gz	IL5RA_HUMAN Interleukin-5 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL5RA PE=1 SV=2
4	AFDB:P21183	0.668	0.686	1.314E-23	415	0.211	0.217	P21183.pdb.gz	IL5RA_MOUSE Interleukin-5 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il5ra PE=1 SV=1
5	AFDB:G3V6S7	0.663	0.635	1.964E-23	448	0.208	0.199	G3V6S7.pdb.gz	G3V6S7_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=2
6	AFDB:Q14627	0.608	0.678	6.895E-23	380	0.201	0.226	Q14627.pdb.gz	I13R2_HUMAN Interleukin-13 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL13RA2 PE=1 SV=1
7	AFDB:Q8VHK6	0.601	0.662	3.112E-22	385	0.220	0.244	Q8VHK6.pdb.gz	I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Il13ra2 PE=2 SV=1
8	AFDB:E6ZCC8	0.552	0.600	6.288E-22	387	0.185	0.204	E6ZCC8.pdb.gz	E6ZCC8_ONCMY IL-13 receptor-alpha-1-a OS=Oncorhynchus mykiss OX=8022 GN=il13Ra1A PE=2 SV=1
9	AFDB:P15509	0.558	0.590	2.791E-17	400	0.183	0.195	P15509.pdb.gz	CSF2R_HUMAN Granulocyte-macrophage colony-stimulating factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CSF2RA PE=1 SV=1
10	AFDB:P32927	0.226	0.117	3.968E-17	897	0.171	0.081	P32927.pdb.gz	IL3RB_HUMAN Cytokine receptor common subunit beta OS=Homo sapiens OX=9606 GN=CSF2RB PE=1 SV=2
11	PDB:7u7nC	0.330	0.618	1.958E-9	200	0.098	0.210	7u7nC.pdb.gz
12	PDB:8eyyA	0.214	0.127	9.293E-9	775	0.087	0.048	8eyyA.pdb.gz
13	PDB:5mj3A	0.280	0.369	3.263E-8	302	0.108	0.152	5mj3A.pdb.gz
14	PDB:6pxvA	0.173	0.102	3.794E-8	823	0.080	0.041	6pxvA.pdb.gz
15	PDB:3besR	0.294	0.442	5.393E-8	250	0.068	0.116	3besR.pdb.gz
16	PDB:6pyhD	0.198	0.119	3.826E-7	798	0.094	0.050	6pyhD.pdb.gz
17	PDB:8dtlA	0.178	0.114	4.023E-7	741	0.094	0.054	8dtlA.pdb.gz
18	PDB:7z0lB	0.323	0.366	9.937E-7	370	0.082	0.095	7z0lB.pdb.gz
19	PDB:1e07A	0.240	0.175	1.741E-5	642	0.084	0.056	1e07A.pdb.gz
20	PDB:5oj2B	0.194	0.136	2.354E-5	692	0.096	0.059	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A7D4	0.0	595	390	0.698	0.764	A0A8I6A7D4_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
2	P78552	0.0	888	427	1.000	1.000	I13R1_HUMAN Interleukin-13 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL13RA1 PE=1 SV=1
3	Q561K3	0.0	618	426	0.724	0.725	Q561K3_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
4	P21183	2.96e-25	108	415	0.211	0.217	IL5RA_MOUSE Interleukin-5 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il5ra PE=1 SV=1
5	Q14627	6.30e-21	95.9	380	0.222	0.250	I13R2_HUMAN Interleukin-13 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL13RA2 PE=1 SV=1
6	Q01344	7.04e-20	93.2	420	0.227	0.231	IL5RA_HUMAN Interleukin-5 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL5RA PE=1 SV=2
7	G3V6S7	1.72e-19	92.4	448	0.206	0.196	G3V6S7_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=2
8	Q99PS3	1.74e-18	89.0	414	0.192	0.198	Q99PS3_RAT Interleukin-5 receptor alpha chain OS=Rattus norvegicus OX=10116 GN=Il5ra PE=2 SV=1
9	O88786	3.79e-17	84.7	383	0.117	0.131	I13R2_MOUSE Interleukin-13 receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Il13ra2 PE=1 SV=1
10	Q8VHK6	4.71e-16	81.6	385	0.115	0.127	I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Il13ra2 PE=2 SV=1
11	A0A8I6A448	4.23e-14	75.9	403	0.190	0.201	A0A8I6A448_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=1
12	P15509	1.39e-13	74.3	400	0.211	0.225	CSF2R_HUMAN Granulocyte-macrophage colony-stimulating factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CSF2RA PE=1 SV=1
13	P31785	1.55e-10	64.7	369	0.152	0.176	IL2RG_HUMAN Cytokine receptor common subunit gamma OS=Homo sapiens OX=9606 GN=IL2RG PE=1 SV=1
14	P34902	4.49e-10	63.2	369	0.176	0.203	IL2RG_MOUSE Cytokine receptor common subunit gamma OS=Mus musculus OX=10090 GN=Il2rg PE=1 SV=1
15	E6ZCC8	2.55e-09	60.8	387	0.162	0.178	E6ZCC8_ONCMY IL-13 receptor-alpha-1-a OS=Oncorhynchus mykiss OX=8022 GN=il13Ra1A PE=2 SV=1
16	P05710	1.90e-08	58.9	610	0.159	0.111	PRLR_RAT Prolactin receptor OS=Rattus norvegicus OX=10116 GN=Prlr PE=1 SV=2
17	Q08501	1.90e-07	55.5	608	0.145	0.102	PRLR_MOUSE Prolactin receptor OS=Mus musculus OX=10090 GN=Prlr PE=1 SV=1
18	P16471	2.78e-07	55.1	622	0.148	0.101	PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606 GN=PRLR PE=1 SV=1
19	Q28172	4.09e-07	54.7	581	0.145	0.107	PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=1 SV=1
20	F1N4H8	5.29e-07	53.1	296	0.145	0.209	F1N4H8_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	0.15	23.6	Erythropoietin receptor, ligand binding
2	PF00041 fn3	0.00015	33.4	Fibronectin type III domain
3	PF18001 Il13Ra_Ig	1.2e-38	142.5	Interleukin-13 receptor subunit alpha Ig-like domain
4	PF09240 IL6Ra-bind	1.5e-25	100.8	Interleukin-6 receptor alpha chain, binding
5	PF17971 LIFR_D2	35	16.0	Leukemia inhibitory factor receptor D2 domain
6	PF18207 LIFR_N	0.43	22.2	Leukemia inhibitory factor receptor N-terminal domain
7	PF01108 Tissue_fac	0.021	26.0	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360730

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304915	0.999	Interleukin-13
2	9606.ENSP00000379111	0.999	Interleukin-4 receptor subunit alpha
3	9606.ENSP00000231449	0.998	Interleukin-4
4	9606.ENSP00000371067	0.984	Tyrosine-protein kinase JAK2
5	9606.ENSP00000343204	0.965	Tyrosine-protein kinase JAK1
6	9606.ENSP00000300134	0.963	Signal transducer and activator of transcription 6
7	9606.ENSP00000431885	0.946	Non-receptor tyrosine-protein kinase TYK2
8	9606.ENSP00000329418	0.929	Suppressor of cytokine signaling 1
9	9606.ENSP00000264563	0.807	Interleukin-11
10	9606.ENSP00000391676	0.762	Tyrosine-protein kinase JAK3
11	9606.ENSP00000231454	0.752	Interleukin-5
12	9606.ENSP00000264657	0.747	Signal transducer and activator of transcription 3
13	9606.ENSP00000412237	0.732	Interleukin-10
14	9606.ENSP00000385675	0.730	Interleukin-6
15	9606.ENSP00000296545	0.729	Interleukin-15
16	9606.ENSP00000229135	0.727	Interferon gamma
17	9606.ENSP00000443410	0.718	Putative nucleotidyltransferase FAM46D
18	9606.ENSP00000343000	0.717	Interleukin-19
19	9606.ENSP00000263851	0.711	Interleukin-7
20	9606.ENSP00000354394	0.710	Signal transducer and activator of transcription 1-alpha/beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	0.995	cytokine receptor activity
GO:0005102	0.321	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051716	0.987	cellular response to stimulus
GO:0007165	0.975	signal transduction
GO:0007166	0.952	cell surface receptor signaling pathway
GO:0048518	0.854	positive regulation of biological process
GO:0019222	0.779	regulation of metabolic process
GO:0048522	0.741	positive regulation of cellular process
GO:0060255	0.730	regulation of macromolecule metabolic process
GO:0010604	0.552	positive regulation of macromolecule metabolic process
GO:0010468	0.547	regulation of gene expression
GO:0042127	0.528	regulation of cell population proliferation
GO:0008284	0.513	positive regulation of cell population proliferation
GO:0051239	0.499	regulation of multicellular organismal process
GO:0002682	0.407	regulation of immune system process
GO:0010628	0.373	positive regulation of gene expression
GO:0051240	0.369	positive regulation of multicellular organismal process
GO:0050865	0.324	regulation of cell activation
GO:0002684	0.323	positive regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.997	protein-containing complex
GO:0098796	0.945	membrane protein complex
GO:0005576	0.938	extracellular region
GO:0043235	0.926	receptor complex
GO:0098802	0.896	plasma membrane signaling receptor complex
GO:0005622	0.733	intracellular anatomical structure
GO:0043227	0.639	membrane-bounded organelle
GO:0043229	0.600	intracellular organelle
GO:0043231	0.579	intracellular membrane-bounded organelle
GO:0005615	0.552	extracellular space
GO:0005898	0.464	interleukin-13 receptor complex
GO:0012505	0.400	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]