StarFunc result for job id P78559

User Input

>input (1400 residues)
MDGVAEFSEYVSETVDVPSPFDLLEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNI
LVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSY
SDWVKNLISPELGVVFFNVPEKLRLPDASRKAKRSIEEACLTLQHLNRLGIQAEPLYRVV
SNTIEPLTLFHKMGVGRLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLPNGKEAEIS
VPYLTSITALVVWLPANPTEKIVRVLFPGNAPQNKILEGLEKLRHLDFLRYPVATQKDLA
SGAVPTNLKPSKIKQRADSKESLKATTKTAVSKLAKREEVVEEGAKEARSELAKELAKTE
KKAKESSEKPPEKPAKPERVKTESSEALKAEKRKLIKDKVGKKHLKEKISKLEEKKDKEK
KEIKKERKELKKDEGRKEEKKDAKKEEKRKDTKPELKKISKPDLKPFTPEVRKTLYKAKV
PGRVKIDRSRAIRGEKELSSEPQTPPAQKGTVPLPTISGHRELVLSSPEDLTQDFEEMKR
EERALLAEQRDTGLGDKPFPLDTAEEGPPSTAIQGTPPSVPGLGQEEHVMKEKELVPEVP
EEQGSKDRGLDSGAETEEEKDTWEEKKQREAERLPDRTEAREESEPEVKEDVIEKAELEE
MEEVHPSDEEEEDATKAEGFYQKHMQEPLKVTPRSREAFGGRELGLQGKAPEKETSLFLS
SLTTPAGATEHVSYIQDETIPGYSETEQTISDEEIHDEPEERPAPPRFHTSTYDLPGPEG
AGPFEASQPADSAVPATSGKVYGTPETELTYPTNIVAAPLAEEEHVSSATSITECDKLSS
FATSVAEDQSVASLTAPQTEETGKSSLLLDTVTSIPSSRTEATQGLDYVPSAGTISPTSS
LEEDKGFKSPPCEDFSVTGESEKRGEIIGKGLSGERAVEEEEEETANVEMSEKLCSQYGT
PVFSAPGHALHPGEPALGEAEERCLSPDDSTVKMASPPPSGPPSATHTPFHQSPVEEKSE
PQDFQEADSWGDTKRTPGVGKEDAAEETVKPGPEEGTLEKEEKVPPPRSPQAQEAPVNID
EGLTGCTIQLLPAQDKAIVFEIMEAGEPTGPILGAEALPGGLRTLPQEPGKPQKDEVLRY
PDRSLSPEDAESLSVLSVPSPDTANQEPTPKSPCGLTEQYLHKDRWPEVSPEDTQSLSLS
EESPSKETSLDVSSKQLSPESLGTLQFGELNLGKEEMGHLMQAEDTSHHTAPMSVPEPHA
ATASPPTDGTTRYSAQTDITDDSLDRKSPASSFSHSTPSGNGKYLPGAITSPDEHILTPD
SSFSKSPESLPGPALEDIAIKWEDKVPGLKDRTSEQKKEPEPKDEVLQQKDKTLEHKEVV
EPKDTAIYQKDEALHVKNEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2ZZ14	0.228	0.161	1.935E-51	2033	0.329	0.227	B2ZZ14.pdb.gz	B2ZZ14_DANRE Hypothetical microtubule-associated protein 1b OS=Danio rerio OX=7955 GN=map1b PE=2 SV=1
2	AFDB:P46821	0.215	0.125	2.049E-51	2468	0.346	0.197	P46821.pdb.gz	MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2
3	PDB:7sn8K	0.065	0.138	1.881E-3	588	0.019	0.044	7sn8K.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
4	PDB:6jkaC	0.078	0.339	3.341E-3	228	0.032	0.197	6jkaC.pdb.gz	Identification of the Inhibitory Compounds for Metallo-beta-lactamases and Structural Analysis of the Binding Modes.
5	PDB:3adrA	0.082	0.323	4.453E-3	259	0.031	0.166	3adrA.pdb.gz	The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; ST1585 from Sulfolobus tokodaii
6	PDB:7bfqB	0.064	0.139	4.716E-3	590	0.019	0.044	7bfqB.pdb.gz
7	PDB:7pksk	0.073	0.193	5.603E-3	458	0.021	0.063	7pksk.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
8	PDB:3zq4A	0.074	0.168	6.285E-3	550	0.021	0.055	3zq4A.pdb.gz	Unusual, Dual Endo- and Exonuclease Activity in the Degradosome Explained by Crystal Structure Analysis of Rnase J1.
9	PDB:2m5cA	0.057	0.240	8.377E-3	227	0.019	0.119	2m5cA.pdb.gz	Solution structures of the Bacillus cereus metallo-beta-lactamase BcII and its complex with the broad spectrum inhibitor R-thiomandelic acid.
10	PDB:2cbnA	0.062	0.225	1.054E-2	306	0.026	0.121	2cbnA.pdb.gz	The Crystal Structure of the Zinc Phosphodiesterase from Escherichia Coli Provides Insight Into Function and Cooperativity of Trnase Z-Family Proteins.
11	AFDB:P47068	0.045	0.052	2.051E-2	1157	0.103	0.124	P47068.pdb.gz	BBC1_YEAST Myosin tail region-interacting protein MTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BBC1 PE=1 SV=2
12	PDB:3zwfA	0.078	0.332	2.100E-2	259	0.025	0.135	3zwfA.pdb.gz	Crystal Structure of Human Trnase Z, Short Form (Elac1).
13	PDB:2ycbB	0.054	0.103	2.799E-2	635	0.018	0.039	2ycbB.pdb.gz	Structure and Activity of a Novel Archaeal Beta-Casp Protein with N-Terminal Kh Domains.
14	AFDB:A0A0R4IVZ0	0.034	0.034	5.141E-2	1436	0.129	0.126	A0A0R4IVZ0.pdb.gz	A0A0R4IVZ0_DANRE Nuclear pore complex protein Nup153 OS=Danio rerio OX=7955 GN=fd23d09 PE=1 SV=1
15	AFDB:Q9Z1Q1	0.033	0.030	7.257E-2	1818	0.139	0.107	Q9Z1Q1.pdb.gz	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
16	AFDB:Q5JV73	0.053	0.044	8.622E-2	1810	0.148	0.114	Q5JV73.pdb.gz	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
17	AFDB:D4A3K7	0.057	0.051	9.672E-2	1705	0.133	0.109	D4A3K7.pdb.gz	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
18	AFDB:Q9VU86	0.032	0.026	9.672E-2	1873	0.102	0.076	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
19	AFDB:Q9JLI2	0.033	0.029	1.217E-1	1739	0.142	0.114	Q9JLI2.pdb.gz	Q9JLI2_MOUSE Collagen type V alpha 3 chain OS=Mus musculus OX=10090 GN=Col5a3 PE=1 SV=1
20	AFDB:I3ISS1	0.044	0.038	1.531E-1	1803	0.154	0.119	I3ISS1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P34926	0.0	2043	2774	0.810	0.409	MAP1A_RAT Microtubule-associated protein 1A OS=Rattus norvegicus OX=10116 GN=Map1a PE=1 SV=1
2	P78559	0.0	2793	2803	1.000	0.499	MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo sapiens OX=9606 GN=MAP1A PE=1 SV=6
3	Q9QYR6	0.0	2046	2776	0.816	0.411	MAP1A_MOUSE Microtubule-associated protein 1A OS=Mus musculus OX=10090 GN=Map1a PE=1 SV=2
4	B2ZZ14	5.91e-171	563	2033	0.303	0.209	B2ZZ14_DANRE Hypothetical microtubule-associated protein 1b OS=Danio rerio OX=7955 GN=map1b PE=2 SV=1
5	P14873	3.45e-162	543	2464	0.189	0.107	MAP1B_MOUSE Microtubule-associated protein 1B OS=Mus musculus OX=10090 GN=Map1b PE=1 SV=2
6	P46821	6.42e-160	536	2468	0.181	0.103	MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2
7	P15205	5.33e-159	533	2461	0.179	0.102	MAP1B_RAT Microtubule-associated protein 1B OS=Rattus norvegicus OX=10116 GN=Map1b PE=1 SV=3
8	Q66K74	1.99e-85	305	1059	0.130	0.172	MAP1S_HUMAN Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S PE=1 SV=2
9	A8K940	5.33e-85	303	1059	0.129	0.171	A8K940_HUMAN cDNA FLJ77630, highly similar to Homo sapiens BPY2 interacting protein 1, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
10	Q8C052	2.45e-71	261	973	0.105	0.151	MAP1S_MOUSE Microtubule-associated protein 1S OS=Mus musculus OX=10090 GN=Map1s PE=1 SV=2
11	P0C5W1	3.33e-71	261	972	0.106	0.152	MAP1S_RAT Microtubule-associated protein 1S OS=Rattus norvegicus OX=10116 GN=Map1s PE=1 SV=1
12	P91859	8.13e-08	59.7	878	0.049	0.079	MAP11_CAEEL Microtubule-associated protein homolog maph-1.1 OS=Caenorhabditis elegans OX=6239 GN=maph-1.1 PE=1 SV=1
13	M9PB32	0.014	42.7	19560	0.089	0.006	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PC41	0.016	42.4	22743	0.089	0.005	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PB30	0.017	42.4	22949	0.089	0.005	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
16	M9PBZ0	0.017	42.4	22830	0.089	0.005	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PBZ4	0.023	42.0	18014	0.089	0.007	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PEH5	0.025	42.0	20710	0.089	0.006	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PEI1	0.025	42.0	21657	0.089	0.006	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PC45	0.026	42.0	22300	0.089	0.006	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16661 Lactamase_B_6	44	14.9	Metallo-beta-lactamase superfamily domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300231

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.992	Disks large homolog 4
2	9606.ENSP00000363970	0.893	Microtubule-associated proteins 1A/1B light chain 3A
3	9606.ENSP00000374455	0.846	Sequestosome-1
4	9606.ENSP00000452037	0.828	Dynein light chain 1, axonemal
5	9606.ENSP00000365272	0.819	Disks large homolog 2
6	9606.ENSP00000272233	0.806	Rho-related GTP-binding protein RhoB
7	9606.ENSP00000268607	0.779	Microtubule-associated proteins 1A/1B light chain 3B
8	9606.ENSP00000355231	0.773	Beclin-1
9	9606.ENSP00000425107	0.766	Ubiquitin-like protein ATG12
10	9606.ENSP00000324464	0.709	Casein kinase I isoform delta
11	9606.ENSP00000358072	0.687	Autophagy protein 5
12	9606.ENSP00000346437	0.680	Ubiquitin-like modifier-activating enzyme ATG7
13	9606.ENSP00000240185	0.644	TAR DNA-binding protein 43
14	9606.ENSP00000286628	0.644	Calcium-activated potassium channel subunit alpha-1
15	9606.ENSP00000250113	0.630	Fragile X mental retardation syndrome-related protein 2
16	9606.ENSP00000350170	0.630	Fragile X mental retardation syndrome-related protein 1
17	9606.ENSP00000359506	0.630	Synaptic functional regulator FMR1
18	9606.ENSP00000375872	0.609	Autophagy-related protein 16-1
19	9606.ENSP00000266458	0.608	Gamma-aminobutyric acid receptor-associated protein-like 1
20	9606.ENSP00000354558	0.607	Serine/threonine-protein kinase mTOR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding
GO:0003779	0.367	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.979	regulation of cellular process
GO:0048519	0.974	negative regulation of biological process
GO:0009987	0.961	cellular process
GO:0048523	0.941	negative regulation of cellular process
GO:0051179	0.909	localization
GO:0010639	0.855	negative regulation of organelle organization
GO:0051641	0.828	cellular localization
GO:0071840	0.789	cellular component organization or biogenesis
GO:0016043	0.775	cellular component organization
GO:0031111	0.771	negative regulation of microtubule polymerization or depolymerization
GO:0051234	0.756	establishment of localization
GO:0051649	0.742	establishment of localization in cell
GO:0006810	0.735	transport
GO:0043244	0.724	regulation of protein-containing complex disassembly
GO:0032501	0.703	multicellular organismal process
GO:0043242	0.687	negative regulation of protein-containing complex disassembly
GO:1902904	0.679	negative regulation of supramolecular fiber organization
GO:1901879	0.677	regulation of protein depolymerization
GO:0046907	0.673	intracellular transport
GO:1901880	0.653	negative regulation of protein depolymerization
GO:0031114	0.641	regulation of microtubule depolymerization
GO:0030705	0.582	cytoskeleton-dependent intracellular transport
GO:0007026	0.520	negative regulation of microtubule depolymerization
GO:0007017	0.467	microtubule-based process
GO:0019222	0.439	regulation of metabolic process
GO:0048518	0.366	positive regulation of biological process
GO:0006996	0.365	organelle organization
GO:0050896	0.326	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	1.000	microtubule cytoskeleton
GO:0032991	0.999	protein-containing complex
GO:0005737	0.995	cytoplasm
GO:0043227	0.983	membrane-bounded organelle
GO:0042995	0.931	cell projection
GO:0120025	0.917	plasma membrane bounded cell projection
GO:0005875	0.913	microtubule associated complex
GO:0005829	0.912	cytosol
GO:0043005	0.721	neuron projection
GO:0043231	0.693	intracellular membrane-bounded organelle
GO:0036477	0.590	somatodendritic compartment
GO:0030424	0.550	axon
GO:0016020	0.512	membrane
GO:0044297	0.498	cell body
GO:0005886	0.471	plasma membrane
GO:0005634	0.406	nucleus
GO:0097447	0.389	dendritic tree
GO:0030425	0.380	dendrite
GO:0043025	0.363	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]