StarFunc result for job id P78560

User Input

>input (199 residues)
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDI
LPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQI
NQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSL
HNGLRAVEVDPSLLLHMLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78560	1.000	1.000	8.533E-28	199	1.000	1.000	P78560.pdb.gz	CRADD_HUMAN Death domain-containing protein CRADD OS=Homo sapiens OX=9606 GN=CRADD PE=1 SV=1
2	AFDB:O88843	0.664	0.664	2.071E-24	199	0.899	0.899	O88843.pdb.gz	CRADD_MOUSE Death domain-containing protein CRADD OS=Mus musculus OX=10090 GN=Cradd PE=1 SV=2
3	AFDB:P29594	0.462	0.208	3.856E-4	452	0.161	0.071	P29594.pdb.gz	CASP2_MOUSE Caspase-2 OS=Mus musculus OX=10090 GN=Casp2 PE=1 SV=5
4	AFDB:Q9IB67	0.446	0.219	4.040E-4	423	0.161	0.076	Q9IB67.pdb.gz	Q9IB67_XENLA Caspase 2 L homeolog OS=Xenopus laevis OX=8355 GN=casp2.L PE=1 SV=1
5	AFDB:P42575	0.461	0.208	6.751E-4	452	0.156	0.069	P42575.pdb.gz	CASP2_HUMAN Caspase-2 OS=Homo sapiens OX=9606 GN=CASP2 PE=1 SV=2
6	AFDB:A0A0R4IXF0	0.386	0.400	8.525E-4	192	0.211	0.219	A0A0R4IXF0.pdb.gz	A0A0R4IXF0_DANRE FAS-associated death domain protein OS=Danio rerio OX=7955 GN=fadd PE=1 SV=1
7	AFDB:A0A288CG41	0.443	0.214	1.799E-3	437	0.176	0.080	A0A288CG41.pdb.gz	A0A288CG41_DANRE Caspase 2 OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
8	AFDB:A0A2U9DQQ3	0.390	0.186	1.885E-3	436	0.171	0.078	A0A2U9DQQ3.pdb.gz
9	AFDB:Q8R3N6	0.452	0.156	3.300E-3	657	0.166	0.050	Q8R3N6.pdb.gz	THOC1_MOUSE THO complex subunit 1 OS=Mus musculus OX=10090 GN=Thoc1 PE=1 SV=1
10	AFDB:Q13158	0.383	0.367	4.367E-3	208	0.151	0.144	Q13158.pdb.gz	FADD_HUMAN FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1
11	PDB:5juyB	0.386	0.069	1.371E-2	1234	0.106	0.017	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
12	PDB:2gf5A	0.318	0.329	2.635E-2	191	0.176	0.183	2gf5A.pdb.gz
13	PDB:4ikmA	0.386	0.177	1.350E-1	463	0.111	0.048	4ikmA.pdb.gz	The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
14	PDB:1dgnA	0.298	0.610	4.137E-1	89	0.065	0.146	1dgnA.pdb.gz
15	PDB:6mksA	0.363	0.719	5.224E-1	90	0.075	0.167	6mksA.pdb.gz
16	PDB:4czzB	0.154	0.200	5.736E-1	133	0.111	0.165	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
17	PDB:4a2wA	0.343	0.112	6.297E-1	678	0.136	0.040	4a2wA.pdb.gz
18	PDB:6ki0A	0.321	0.148	7.243E-1	459	0.090	0.039	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
19	PDB:4irlB	0.375	0.173	1.528	463	0.121	0.052	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
20	PDB:2kn6A	0.276	0.280	1.678	195	0.156	0.159	2kn6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78560	4.44e-147	408	199	1.000	1.000	CRADD_HUMAN Death domain-containing protein CRADD OS=Homo sapiens OX=9606 GN=CRADD PE=1 SV=1
2	O88843	6.45e-132	370	199	0.899	0.899	CRADD_MOUSE Death domain-containing protein CRADD OS=Mus musculus OX=10090 GN=Cradd PE=1 SV=2
3	Q0PKX3	6.05e-08	53.9	435	0.136	0.062	Q0PKX3_DANRE Caspase 2, apoptosis-related cysteine peptidase OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
4	A0A288CG41	6.18e-08	53.9	437	0.136	0.062	A0A288CG41_DANRE Caspase 2 OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
5	Q9IB67	5.99e-07	51.2	423	0.136	0.064	Q9IB67_XENLA Caspase 2 L homeolog OS=Xenopus laevis OX=8355 GN=casp2.L PE=1 SV=1
6	F1QSB1	2.89e-04	43.1	436	0.141	0.064	F1QSB1_DANRE Caspase 9, apoptosis-related cysteine peptidase OS=Danio rerio OX=7955 GN=im:7136887 PE=1 SV=1
7	P29594	0.014	38.1	452	0.121	0.053	CASP2_MOUSE Caspase-2 OS=Mus musculus OX=10090 GN=Casp2 PE=1 SV=5
8	P42575	0.021	37.4	452	0.075	0.033	CASP2_HUMAN Caspase-2 OS=Homo sapiens OX=9606 GN=CASP2 PE=1 SV=2
9	P55215	0.030	37.0	452	0.075	0.033	CASP2_RAT Caspase-2 OS=Rattus norvegicus OX=10116 GN=Casp2 PE=1 SV=3
10	E7F8A6	0.065	35.8	241	0.101	0.083	E7F8A6_DANRE B-cell lymphoma/leukemia 10 isoform X1 OS=Danio rerio OX=7955 GN=bcl10 PE=4 SV=1
11	Q13158	0.12	34.7	208	0.085	0.082	FADD_HUMAN FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1
12	Q9QYN5	0.19	34.3	233	0.131	0.112	BCL10_RAT B-cell lymphoma/leukemia 10 OS=Rattus norvegicus OX=10116 GN=Bcl10 PE=2 SV=1
13	O95999	0.22	33.9	233	0.131	0.112	BCL10_HUMAN B-cell lymphoma/leukemia 10 OS=Homo sapiens OX=9606 GN=BCL10 PE=1 SV=1
14	Q9Z0H7	0.48	33.1	233	0.126	0.107	BCL10_MOUSE B-cell lymphoma/leukemia 10 OS=Mus musculus OX=10090 GN=Bcl10 PE=1 SV=1
15	A0A0R4IXF0	0.62	32.3	192	0.111	0.115	A0A0R4IXF0_DANRE FAS-associated death domain protein OS=Danio rerio OX=7955 GN=fadd PE=1 SV=1
16	E9PCH6	0.84	32.7	1048	0.095	0.018	E9PCH6_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZI16	0.85	32.7	1055	0.095	0.018	A0A5F9ZI16_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A0C5AQN2	0.87	32.3	207	0.111	0.106	A0A0C5AQN2_ONCMY BCL10 protein OS=Oncorhynchus mykiss OX=8022 GN=BCL10 PE=2 SV=1
19	A0A5F9ZH18	0.87	32.7	1109	0.095	0.017	A0A5F9ZH18_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZH99	0.89	32.7	1060	0.095	0.018	A0A5F9ZH99_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	1.9e-12	58.3	Caspase recruitment domain
2	PF00531 Death	8.2e-10	50.0	Death domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000439068

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312664	0.999	Caspase-2
2	9606.ENSP00000337797	0.999	P53-induced death domain-containing protein 1
3	9606.ENSP00000301838	0.970	FAS-associated death domain protein
4	9606.ENSP00000259808	0.968	Receptor-interacting serine/threonine-protein kinase 1
5	9606.ENSP00000341268	0.965	Tumor necrosis factor receptor type 1-associated DEATH domain protein
6	9606.ENSP00000351273	0.964	Caspase-8
7	9606.ENSP00000162749	0.963	Tumor necrosis factor receptor superfamily member 1A
8	9606.ENSP00000263464	0.928	Baculoviral IAP repeat-containing protein 3
9	9606.ENSP00000318822	0.923	BH3-interacting domain death agonist
10	9606.ENSP00000398698	0.920	Tumor necrosis factor
11	9606.ENSP00000247668	0.919	TNF receptor-associated factor 2
12	9606.ENSP00000362994	0.917	TNF receptor-associated factor 1
13	9606.ENSP00000351908	0.907	Mitogen-activated protein kinase kinase kinase 5
14	9606.ENSP00000381070	0.906	Dual specificity mitogen-activated protein kinase kinase 7
15	9606.ENSP00000410402	0.904	Dual specificity mitogen-activated protein kinase kinase 4
16	9606.ENSP00000287322	0.901	BAG family molecular chaperone regulator 4
17	9606.ENSP00000376505	0.901	TRAF family member-associated NF-kappa-B activator
18	9606.ENSP00000411012	0.901	Protein FAN
19	9606.ENSP00000219334	0.900	Sphingomyelin phosphodiesterase 3
20	9606.ENSP00000294066	0.900	Mitogen-activated protein kinase kinase kinase kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030674	1.000	protein-macromolecule adaptor activity
GO:0019904	1.000	protein domain specific binding
GO:0002020	1.000	protease binding
GO:0042802	0.859	identical protein binding
GO:0070513	0.675	death domain binding
GO:0005102	0.378	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.985	response to stimulus
GO:0009987	0.985	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0051716	0.984	cellular response to stimulus
GO:0048518	0.977	positive regulation of biological process
GO:0048519	0.973	negative regulation of biological process
GO:0006950	0.970	response to stress
GO:0043065	0.969	positive regulation of apoptotic process
GO:0060255	0.959	regulation of macromolecule metabolic process
GO:0097190	0.959	apoptotic signaling pathway
GO:0080090	0.956	regulation of primary metabolic process
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0023051	0.953	regulation of signaling
GO:0048583	0.951	regulation of response to stimulus
GO:0009966	0.942	regulation of signal transduction
GO:0048523	0.938	negative regulation of cellular process
GO:0010604	0.931	positive regulation of macromolecule metabolic process
GO:0033554	0.917	cellular response to stress
GO:0009605	0.914	response to external stimulus
GO:0051246	0.905	regulation of protein metabolic process
GO:0042770	0.904	signal transduction in response to DNA damage
GO:0071260	0.897	cellular response to mechanical stimulus
GO:2001056	0.896	positive regulation of cysteine-type endopeptidase activity
GO:0000077	0.883	DNA damage checkpoint signaling
GO:0007166	0.881	cell surface receptor signaling pathway
GO:1901990	0.873	regulation of mitotic cell cycle phase transition
GO:1902806	0.870	regulation of cell cycle G1/S phase transition
GO:0045930	0.869	negative regulation of mitotic cell cycle
GO:0043280	0.861	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0048584	0.858	positive regulation of response to stimulus
GO:2001233	0.850	regulation of apoptotic signaling pathway
GO:0009967	0.782	positive regulation of signal transduction
GO:0007093	0.767	mitotic cell cycle checkpoint signaling
GO:2000045	0.762	regulation of G1/S transition of mitotic cell cycle
GO:0044773	0.758	mitotic DNA damage checkpoint signaling
GO:2001235	0.744	positive regulation of apoptotic signaling pathway
GO:1901991	0.739	negative regulation of mitotic cell cycle phase transition
GO:2000134	0.715	negative regulation of G1/S transition of mitotic cell cycle
GO:0072331	0.704	signal transduction by p53 class mediator
GO:1902531	0.542	regulation of intracellular signal transduction
GO:0097191	0.521	extrinsic apoptotic signaling pathway
GO:0030330	0.511	DNA damage response, signal transduction by p53 class mediator
GO:0044819	0.511	mitotic G1/S transition checkpoint signaling
GO:0008152	0.477	metabolic process
GO:0071704	0.454	organic substance metabolic process
GO:0008625	0.451	extrinsic apoptotic signaling pathway via death domain receptors
GO:1902533	0.430	positive regulation of intracellular signal transduction
GO:0044238	0.378	primary metabolic process
GO:0031323	0.356	regulation of cellular metabolic process
GO:0010468	0.349	regulation of gene expression
GO:0006807	0.342	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0032991	0.995	protein-containing complex
GO:0005634	0.959	nucleus
GO:0016020	0.881	membrane
GO:1902494	0.845	catalytic complex
GO:1905368	0.693	peptidase complex
GO:1905369	0.635	endopeptidase complex
GO:0070013	0.542	intracellular organelle lumen
GO:0031981	0.367	nuclear lumen
GO:0012505	0.315	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]