StarFunc result for job id P78563

User Input

>input (741 residues)
MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEEGSN
GHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAPLFVMSVEVNGQVF
EGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGF
ETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMIL
NELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLH
LDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTG
TDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDD
QKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEGSRSYTQAGVQWCNH
GSLQPRPPGLLSDPSTSTFQGAGTTEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQ
TWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAM
YQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDE
LGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFI
KAGLGAWVEKPTEQDQFSLTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51400	0.826	0.860	0.000	711	0.901	0.940	P51400.pdb.gz	RED1_RAT Double-stranded RNA-specific editase 1 OS=Rattus norvegicus OX=10116 GN=Adarb1 PE=1 SV=1
2	AFDB:P78563	1.000	1.000	0.000	741	1.000	1.000	P78563.pdb.gz	RED1_HUMAN Double-stranded RNA-specific editase 1 OS=Homo sapiens OX=9606 GN=ADARB1 PE=1 SV=1
3	AFDB:A5WUX1	0.768	0.789	4.546E-101	720	0.691	0.711	A5WUX1.pdb.gz
4	AFDB:Q9NS39	0.505	0.507	4.259E-78	739	0.501	0.502	Q9NS39.pdb.gz	RED2_HUMAN Double-stranded RNA-specific editase B2 OS=Homo sapiens OX=9606 GN=ADARB2 PE=1 SV=1
5	AFDB:Q9NII1	0.630	0.686	4.066E-70	676	0.430	0.472	Q9NII1.pdb.gz	ADAR_DROME Double-stranded RNA-specific editase Adar OS=Drosophila melanogaster OX=7227 GN=Adar PE=1 SV=2
6	AFDB:Q9U3D6	0.408	0.321	3.340E-29	964	0.190	0.146	Q9U3D6.pdb.gz	ADR1_CAEEL A-to-I RNA editing regulator adr-1 OS=Caenorhabditis elegans OX=6239 GN=adr-1 PE=1 SV=2
7	AFDB:Q91WM1	0.184	0.202	6.800E-18	672	0.151	0.167	Q91WM1.pdb.gz	STRBP_MOUSE Spermatid perinuclear RNA-binding protein OS=Mus musculus OX=10090 GN=Strbp PE=1 SV=1
8	AFDB:Q9Z1X4	0.180	0.151	1.978E-16	898	0.154	0.127	Q9Z1X4.pdb.gz	ILF3_MOUSE Interleukin enhancer-binding factor 3 OS=Mus musculus OX=10090 GN=Ilf3 PE=1 SV=2
9	AFDB:Q6DD04	0.137	0.118	3.407E-16	898	0.139	0.115	Q6DD04.pdb.gz	ILF3B_XENLA Interleukin enhancer-binding factor 3-B OS=Xenopus laevis OX=8355 GN=ilf3-b PE=1 SV=2
10	AFDB:Q2TAV5	0.177	0.147	9.570E-16	902	0.143	0.118	Q2TAV5.pdb.gz	Q2TAV5_XENLA CBTF122 protein OS=Xenopus laevis OX=8355 GN=ilf3.S PE=2 SV=1
11	PDB:7zpkC	0.110	0.285	6.744E-10	233	0.082	0.262	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
12	PDB:8dfvK	0.080	0.218	1.290E-6	253	0.061	0.178	8dfvK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
13	PDB:7v6cB	0.088	0.244	1.660E-5	260	0.051	0.146	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
14	PDB:8dgaK	0.083	0.298	9.456E-5	182	0.051	0.209	8dgaK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
15	PDB:1yykA	0.088	0.284	9.275E-4	221	0.030	0.100	1yykA.pdb.gz	Intermediate states of ribonuclease III in complex with double-stranded RNA
16	PDB:7r97A	0.084	0.268	1.513E-3	226	0.026	0.084	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
17	PDB:7l08c	0.085	0.209	3.812E-3	289	0.026	0.066	7l08c.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
18	PDB:5aorA	0.080	0.060	4.738E-3	1009	0.049	0.036	5aorA.pdb.gz	Structure of the RNA Helicase Mle Reveals the Molecular Mechanisms for Uridine Specificity and RNA-ATP Coupling.
19	PDB:3j6b5	0.083	0.180	6.565E-3	326	0.023	0.052	3j6b5.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
20	PDB:7yz4A	0.078	0.048	1.194E-2	1234	0.026	0.015	7yz4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51400	0.0	1340	711	0.904	0.942	RED1_RAT Double-stranded RNA-specific editase 1 OS=Rattus norvegicus OX=10116 GN=Adarb1 PE=1 SV=1
2	P78563	0.0	1529	741	1.000	1.000	RED1_HUMAN Double-stranded RNA-specific editase 1 OS=Homo sapiens OX=9606 GN=ADARB1 PE=1 SV=1
3	Q91ZS8	0.0	1340	711	0.903	0.941	RED1_MOUSE Double-stranded RNA-specific editase 1 OS=Mus musculus OX=10090 GN=Adarb1 PE=1 SV=1
4	Q9NS39	0.0	717	739	0.509	0.510	RED2_HUMAN Double-stranded RNA-specific editase B2 OS=Homo sapiens OX=9606 GN=ADARB2 PE=1 SV=1
5	Q9NII1	1.37e-170	508	676	0.416	0.456	ADAR_DROME Double-stranded RNA-specific editase Adar OS=Drosophila melanogaster OX=7227 GN=Adar PE=1 SV=2
6	F1MUM9	8.17e-75	265	1149	0.239	0.154	F1MUM9_BOVIN Adenosine deaminase RNA specific OS=Bos taurus OX=9913 GN=ADAR PE=1 SV=3
7	A0A3B3IRQ9	4.38e-74	263	1158	0.239	0.153	A0A3B3IRQ9_HUMAN Double-stranded RNA-specific adenosine deaminase (Fragment) OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=1
8	P55265	6.80e-74	263	1226	0.244	0.148	DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4
9	Q99MU3	3.47e-72	258	1178	0.244	0.154	DSRAD_MOUSE Double-stranded RNA-specific adenosine deaminase OS=Mus musculus OX=10090 GN=Adar PE=1 SV=2
10	P55266	1.27e-71	256	1175	0.244	0.154	DSRAD_RAT Double-stranded RNA-specific adenosine deaminase OS=Rattus norvegicus OX=10116 GN=Adar PE=1 SV=1
11	Q22618	2.38e-56	202	495	0.205	0.307	DSRAD_CAEEL Double-stranded RNA-specific adenosine deaminase adr-2 OS=Caenorhabditis elegans OX=6239 GN=adr-2 PE=1 SV=2
12	Q5SUE7	1.77e-41	162	619	0.225	0.270	ADAD1_MOUSE Adenosine deaminase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Adad1 PE=1 SV=1
13	Q6DD04	4.13e-38	154	898	0.131	0.108	ILF3B_XENLA Interleukin enhancer-binding factor 3-B OS=Xenopus laevis OX=8355 GN=ilf3-b PE=1 SV=2
14	Q91550	8.50e-38	154	897	0.136	0.113	ILF3A_XENLA Interleukin enhancer-binding factor 3-A OS=Xenopus laevis OX=8355 GN=ilf3-a PE=1 SV=2
15	Q2TAV5	2.19e-37	152	902	0.136	0.112	Q2TAV5_XENLA CBTF122 protein OS=Xenopus laevis OX=8355 GN=ilf3.S PE=2 SV=1
16	F4HU58	5.05e-35	140	420	0.165	0.290	TAD1_ARATH tRNA-specific adenosine deaminase TAD1 OS=Arabidopsis thaliana OX=3702 GN=TAD1 PE=1 SV=1
17	Q9Z1X4	4.90e-34	142	898	0.124	0.102	ILF3_MOUSE Interleukin enhancer-binding factor 3 OS=Mus musculus OX=10090 GN=Ilf3 PE=1 SV=2
18	Q91WM1	5.47e-34	140	672	0.130	0.143	STRBP_MOUSE Spermatid perinuclear RNA-binding protein OS=Mus musculus OX=10090 GN=Strbp PE=1 SV=1
19	A0A0S2Z5K8	6.19e-34	140	657	0.130	0.146	A0A0S2Z5K8_HUMAN Spermatid perinuclear RNA-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=STRBP PE=1 SV=1
20	Q96SI9	7.85e-34	140	672	0.130	0.143	STRBP_HUMAN Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02137 A_deamin	3.1e-112	386.9	Adenosine-deaminase (editase) domain
2	PF14709 DND1_DSRM	1.5e+02	14.1	double strand RNA binding domain from DEAD END PROTEIN 1
3	PF00035 dsrm	3.2e-23	93.5	Double-stranded RNA binding motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353920

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379204	0.978	Bone morphogenetic protein 7
2	9606.ENSP00000398744	0.862	Adenosine deaminase-like protein
3	9606.ENSP00000379802	0.778	AMP deaminase 3
4	9606.ENSP00000350162	0.777	Synaptonemal complex protein 2
5	9606.ENSP00000357459	0.777	Double-stranded RNA-specific adenosine deaminase
6	9606.ENSP00000339613	0.764	GDP-fucose protein O-fucosyltransferase 2
7	9606.ENSP00000357612	0.764	Zinc transporter ZIP1
8	9606.ENSP00000256578	0.752	AMP deaminase 2
9	9606.ENSP00000430075	0.740	AMP deaminase 1
10	9606.ENSP00000395196	0.730	Probable glutamate--tRNA ligase, mitochondrial
11	9606.ENSP00000296526	0.719	Glutamate receptor 2
12	9606.ENSP00000318176	0.703	Interferon-inducible double-stranded RNA-dependent protein kinase activator A
13	9606.ENSP00000233057	0.699	Interferon-induced, double-stranded RNA-activated protein kinase
14	9606.ENSP00000361965	0.698	Adenosine deaminase
15	9606.ENSP00000360922	0.695	Double-stranded RNA-binding protein Staufen homolog 1
16	9606.ENSP00000266987	0.681	RISC-loading complex subunit TARBP2
17	9606.ENSP00000270257	0.672	Gem-associated protein 7
18	9606.ENSP00000473370	0.663	Meiosis-specific protein MEI4
19	9606.ENSP00000350869	0.658	Zinc finger protein 346
20	9606.ENSP00000442308	0.658	NF-kappa-B-repressing factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0004000	1.000	adenosine deaminase activity
GO:0003725	1.000	double-stranded RNA binding
GO:0003729	0.832	mRNA binding
GO:0003726	0.718	double-stranded RNA adenosine deaminase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0006807	0.974	nitrogen compound metabolic process
GO:0043170	0.956	macromolecule metabolic process
GO:0006139	0.939	nucleobase-containing compound metabolic process
GO:0090304	0.911	nucleic acid metabolic process
GO:0065007	0.903	biological regulation
GO:0016070	0.885	RNA metabolic process
GO:0050789	0.874	regulation of biological process
GO:0050794	0.823	regulation of cellular process
GO:0043412	0.718	macromolecule modification
GO:0016553	0.693	base conversion or substitution editing
GO:0060255	0.680	regulation of macromolecule metabolic process
GO:0051171	0.629	regulation of nitrogen compound metabolic process
GO:0080090	0.623	regulation of primary metabolic process
GO:0048518	0.615	positive regulation of biological process
GO:0031323	0.576	regulation of cellular metabolic process
GO:0032501	0.462	multicellular organismal process
GO:0032502	0.436	developmental process
GO:0048519	0.414	negative regulation of biological process
GO:0048523	0.402	negative regulation of cellular process
GO:0030154	0.372	cell differentiation
GO:0048468	0.361	cell development
GO:0010468	0.327	regulation of gene expression
GO:0007275	0.323	multicellular organism development
GO:0009892	0.311	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005654	0.996	nucleoplasm
GO:0005829	0.988	cytosol
GO:0005730	0.970	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24408	1.000	adenosine + H(+) + H2O = inosine + NH4(+)
EC:3.5.4.4	1.000	adenosine deaminase.

[back to server]