StarFunc result for job id P79483

User Input

>input (266 residues)
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYF
HNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTV
QRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P79483	1.000	1.000	5.456E-49	266	1.000	1.000	P79483.pdb.gz	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
2	AFDB:A0A0G4PYZ0	0.825	0.825	2.876E-44	266	0.891	0.891	A0A0G4PYZ0.pdb.gz	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
3	AFDB:Q30154	0.818	0.818	1.817E-41	266	0.868	0.868	Q30154.pdb.gz	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
4	AFDB:P13762	0.792	0.792	4.042E-41	266	0.846	0.846	P13762.pdb.gz	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
5	AFDB:P04230	0.740	0.745	3.335E-38	264	0.729	0.735	P04230.pdb.gz	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
6	AFDB:P18211	0.716	0.721	1.936E-37	264	0.680	0.686	P18211.pdb.gz	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
7	AFDB:P05538	0.754	0.750	1.482E-32	268	0.617	0.612	P05538.pdb.gz	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
8	AFDB:P29826	0.766	0.774	7.732E-32	263	0.583	0.589	P29826.pdb.gz	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
9	AFDB:A0A1C3PI11	0.722	0.742	2.498E-31	258	0.564	0.581	A0A1C3PI11.pdb.gz	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
10	AFDB:P01920	0.757	0.769	9.466E-31	261	0.583	0.594	P01920.pdb.gz	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
11	PDB:6cplA	0.391	0.563	1.109E-13	180	0.154	0.228	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
12	PDB:3es6A	0.509	0.492	9.865E-13	277	0.147	0.141	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
13	PDB:5j6hA	0.471	0.458	1.577E-11	275	0.162	0.156	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
14	PDB:6fgbA	0.514	0.515	9.653E-11	265	0.158	0.158	6fgbA.pdb.gz
15	PDB:1cd1A	0.535	0.523	1.133E-10	273	0.147	0.143	1cd1A.pdb.gz
16	PDB:6d7gA	0.432	0.326	1.260E-10	386	0.158	0.109	6d7gA.pdb.gz
17	PDB:6e1iA	0.441	0.331	2.147E-10	389	0.169	0.116	6e1iA.pdb.gz
18	PDB:3s6cA	0.503	0.374	3.289E-10	372	0.180	0.129	3s6cA.pdb.gz
19	PDB:6mp0A	0.453	0.337	1.627E-9	388	0.154	0.106	6mp0A.pdb.gz
20	PDB:1kjvB	0.345	0.882	2.014E-9	100	0.113	0.300	1kjvB.pdb.gz	Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P79483	0.0	549	266	1.000	1.000	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
2	A0A0G4PYZ0	4.08e-169	469	266	0.891	0.891	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
3	P01911	3.27e-167	464	266	0.891	0.891	DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=2
4	Q30154	3.13e-162	452	266	0.868	0.868	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
5	P13762	2.25e-159	445	266	0.846	0.846	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
6	P18468	4.43e-145	409	264	0.726	0.731	HB2I_MOUSE H-2 class II histocompatibility antigen, I-A beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
7	P18469	1.71e-136	387	264	0.722	0.727	HB2J_MOUSE H-2 class II histocompatibility antigen, I-E beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
8	P04230	9.78e-136	385	264	0.729	0.735	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
9	P04231	1.03e-127	363	232	0.684	0.784	HB23_MOUSE H-2 class II histocompatibility antigen, E-S beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
10	P18211	1.36e-125	359	264	0.680	0.686	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
11	P04440	1.91e-110	321	258	0.579	0.597	DPB1_HUMAN HLA class II histocompatibility antigen, DP beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
12	Q30059	2.20e-110	320	258	0.571	0.589	Q30059_HUMAN MHC class II lymphocyte antigen beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=2 SV=1
13	P06342	2.73e-110	320	265	0.586	0.589	HB2Q_MOUSE H-2 class II histocompatibility antigen, A-Q beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
14	A0A1C3PI11	2.84e-109	318	258	0.564	0.581	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
15	P14483	4.96e-109	317	265	0.583	0.585	HB2A_MOUSE H-2 class II histocompatibility antigen, A beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
16	P01921	5.53e-109	317	265	0.579	0.581	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
17	Q95HA4	2.42e-108	315	257	0.560	0.580	Q95HA4_HUMAN HLA-DPB1 protein OS=Homo sapiens OX=9606 PE=1 SV=1
18	P06345	6.89e-108	314	263	0.594	0.601	HB2S_MOUSE H-2 class II histocompatibility antigen, A-S beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
19	P05538	1.42e-106	311	268	0.617	0.612	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
20	P06346	2.02e-105	308	252	0.575	0.607	HB2F_MOUSE H-2 class II histocompatibility antigen, A-F beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	6.1e-23	92.3	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	4e+02	12.5	CD80-like C2-set immunoglobulin domain
3	PF02656 DUF202	3e+02	13.3	Domain of unknown function (DUF202)
4	PF07679 I-set	2.9e+02	12.9	Immunoglobulin I-set domain
5	PF00047 ig	1.5	20.4	Immunoglobulin domain
6	PF13895 Ig_2	49	15.7	Immunoglobulin domain
7	PF13927 Ig_3	0.075	24.9	Immunoglobulin domain
8	PF00969 MHC_II_beta	3e-33	125.1	Class II histocompatibility antigen, beta domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000016035

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000012377	0.977	Major histocompatibility complex, class II, DR alpha
2	9555.ENSPANP00000000660	0.938	CD74 molecule, major histocompatibility complex, class II invariant chain
3	9555.ENSPANP00000012378	0.935	Belongs to the MHC class II family.
4	9555.ENSPANP00000012393	0.926	annotation not available
5	9555.ENSPANP00000012394	0.924	Major histocompatibility complex, class II, DM alpha
6	9555.ENSPANP00000017788	0.841	annotation not available
7	9555.ENSPANP00000012379	0.836	annotation not available
8	9555.ENSPANP00000012398	0.834	Major histocompatibility complex, class II, DO alpha
9	9555.ENSPANP00000012400	0.804	Major histocompatibility complex, class II, DP alpha 1
10	9555.ENSPANP00000004160	0.801	CD4 molecule
11	9555.ENSPANP00000011192	0.741	Protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
12	9555.ENSPANP00000004702	0.681	Papio anubis CD247 molecule (CD247), mRNA
13	9555.ENSPANP00000010755	0.668	Protein tyrosine phosphatase, receptor type, C
14	9555.ENSPANP00000012383	0.665	Major histocompatibility complex, class II, DO beta
15	9555.ENSPANP00000011476	0.660	Papio anubis CD86 molecule (CD86), mRNA
16	9555.ENSPANP00000015332	0.650	CD80 molecule
17	9555.ENSPANP00000011738	0.643	Cathepsin S
18	9555.ENSPANP00000001916	0.627	CD3e molecule, epsilon (CD3-TCR complex)
19	9555.ENSPANP00000011679	0.614	Papio anubis CD28 molecule (CD28), mRNA
20	9555.ENSPANP00000003262	0.593	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.784	antigen binding
GO:0042277	0.733	peptide binding
GO:0042605	0.702	peptide antigen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0050789	0.978	regulation of biological process
GO:0002376	0.957	immune system process
GO:0019882	0.933	antigen processing and presentation
GO:0002504	0.916	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
GO:0019886	0.912	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0009987	0.905	cellular process
GO:0050794	0.888	regulation of cellular process
GO:0002682	0.840	regulation of immune system process
GO:0048518	0.735	positive regulation of biological process
GO:0051716	0.514	cellular response to stimulus
GO:0048583	0.483	regulation of response to stimulus
GO:0007165	0.478	signal transduction
GO:0048522	0.475	positive regulation of cellular process
GO:0006955	0.442	immune response
GO:0019222	0.441	regulation of metabolic process
GO:0060255	0.421	regulation of macromolecule metabolic process
GO:0002684	0.419	positive regulation of immune system process
GO:0048519	0.410	negative regulation of biological process
GO:0048584	0.407	positive regulation of response to stimulus
GO:0050776	0.383	regulation of immune response
GO:0050778	0.332	positive regulation of immune response
GO:0051249	0.330	regulation of lymphocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0031410	1.000	cytoplasmic vesicle
GO:0005794	0.997	Golgi apparatus
GO:0098588	0.996	bounding membrane of organelle
GO:0005764	0.996	lysosome
GO:0030659	0.994	cytoplasmic vesicle membrane
GO:0005768	0.993	endosome
GO:0098796	0.988	membrane protein complex
GO:0005765	0.987	lysosomal membrane
GO:0031984	0.983	organelle subcompartment
GO:0098552	0.981	side of membrane
GO:0030135	0.978	coated vesicle
GO:0030139	0.977	endocytic vesicle
GO:0005770	0.976	late endosome
GO:0010008	0.975	endosome membrane
GO:0005783	0.974	endoplasmic reticulum
GO:0030666	0.974	endocytic vesicle membrane
GO:0030662	0.974	coated vesicle membrane
GO:0030134	0.966	COPII-coated ER to Golgi transport vesicle
GO:0000139	0.950	Golgi membrane
GO:0098797	0.949	plasma membrane protein complex
GO:0030136	0.946	clathrin-coated vesicle
GO:0012507	0.945	ER to Golgi transport vesicle membrane
GO:0005576	0.942	extracellular region
GO:0005789	0.940	endoplasmic reticulum membrane
GO:0030669	0.935	clathrin-coated endocytic vesicle membrane
GO:0098576	0.915	lumenal side of membrane
GO:0032588	0.915	trans-Golgi network membrane
GO:0098553	0.907	lumenal side of endoplasmic reticulum membrane
GO:0005615	0.906	extracellular space
GO:0042611	0.900	MHC protein complex
GO:0042613	0.870	MHC class II protein complex
GO:0031902	0.826	late endosome membrane
GO:1903561	0.784	extracellular vesicle
GO:0070062	0.759	extracellular exosome
GO:0009986	0.564	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]