StarFunc result for job id P80075

User Input

>input (99 residues)
MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P80075	1.000	1.000	2.633E-19	99	1.000	1.000	P80075.pdb.gz	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
2	AFDB:P13500	0.699	0.699	4.424E-15	99	0.687	0.687	P13500.pdb.gz	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
3	AFDB:P51671	0.700	0.714	1.219E-14	97	0.687	0.701	P51671.pdb.gz	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
4	AFDB:D4ABS1	0.797	0.804	1.709E-14	98	0.626	0.633	D4ABS1.pdb.gz	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
5	AFDB:P80098	0.712	0.712	4.400E-14	99	0.646	0.646	P80098.pdb.gz	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
6	PDB:1esrA	0.699	0.897	6.295E-14	76	0.758	0.987	1esrA.pdb.gz
7	AFDB:Q9Z121	0.714	0.728	2.082E-13	97	0.535	0.546	Q9Z121.pdb.gz	CCL8_MOUSE C-C motif chemokine 8 OS=Mus musculus OX=10090 GN=Ccl8 PE=3 SV=1
8	AFDB:P48298	0.709	0.722	9.203E-13	97	0.525	0.536	P48298.pdb.gz	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
9	AFDB:Q99616	0.683	0.689	1.053E-12	98	0.606	0.612	Q99616.pdb.gz	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
10	AFDB:Q62401	0.781	0.746	2.370E-12	104	0.556	0.529	Q62401.pdb.gz	CCL12_MOUSE C-C motif chemokine 12 OS=Mus musculus OX=10090 GN=Ccl12 PE=2 SV=1
11	AFDB:P10148	0.709	0.483	4.069E-12	148	0.505	0.338	P10148.pdb.gz	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
12	PDB:1domA	0.651	0.831	1.697E-9	76	0.475	0.618	1domA.pdb.gz
13	PDB:2ra4B	0.606	0.899	6.555E-9	65	0.364	0.554	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
14	PDB:2mpmA	0.544	0.700	1.052E-8	74	0.475	0.635	2mpmA.pdb.gz	Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
15	PDB:1bo0A	0.584	0.737	2.067E-8	76	0.424	0.553	1bo0A.pdb.gz
16	PDB:4zltF	0.567	0.881	6.938E-7	62	0.263	0.419	4zltF.pdb.gz
17	PDB:2q8tB	0.591	0.885	1.191E-6	65	0.273	0.415	2q8tB.pdb.gz
18	PDB:5yamA	0.567	0.786	1.787E-6	69	0.192	0.275	5yamA.pdb.gz
19	PDB:7f1tA	0.587	0.143	2.505E-6	423	0.273	0.064	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
20	PDB:1g2sA	0.535	0.722	4.601E-6	71	0.253	0.352	1g2sA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P80075	3.88e-70	206	99	1.000	1.000	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
2	Q99616	5.49e-41	132	98	0.616	0.622	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
3	Q62401	7.08e-39	127	104	0.586	0.558	CCL12_MOUSE C-C motif chemokine 12 OS=Mus musculus OX=10090 GN=Ccl12 PE=2 SV=1
4	P13500	3.64e-38	125	99	0.687	0.687	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
5	P51671	9.71e-37	121	97	0.687	0.701	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
6	Q9Z121	2.71e-33	112	97	0.535	0.546	CCL8_MOUSE C-C motif chemokine 8 OS=Mus musculus OX=10090 GN=Ccl8 PE=3 SV=1
7	P80098	4.69e-33	112	99	0.515	0.515	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
8	D4ABS1	1.64e-32	110	98	0.515	0.520	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
9	P48298	6.34e-32	109	97	0.535	0.546	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
10	P10148	4.36e-30	106	148	0.495	0.331	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
11	P14844	1.15e-28	102	148	0.465	0.311	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
12	P97545	1.20e-27	98.6	97	0.465	0.474	CCL11_RAT Eotaxin OS=Rattus norvegicus OX=10116 GN=Ccl11 PE=3 SV=1
13	Q9QXY8	5.75e-27	96.7	97	0.495	0.505	CCL7_RAT C-C motif chemokine 7 OS=Rattus norvegicus OX=10116 GN=Ccl7 PE=3 SV=1
14	Q03366	1.30e-19	78.2	97	0.525	0.536	CCL7_MOUSE C-C motif chemokine 7 OS=Mus musculus OX=10090 GN=Ccl7 PE=3 SV=1
15	P16619	1.62e-18	75.1	93	0.384	0.409	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
16	P13236	3.00e-17	72.0	92	0.343	0.370	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
17	Q9JKC0	9.65e-16	68.9	119	0.374	0.311	CCL24_MOUSE C-C motif chemokine 24 OS=Mus musculus OX=10090 GN=Ccl24 PE=2 SV=1
18	O00175	1.81e-15	68.2	119	0.364	0.303	CCL24_HUMAN C-C motif chemokine 24 OS=Homo sapiens OX=9606 GN=CCL24 PE=1 SV=2
19	P50230	4.25e-15	66.6	92	0.323	0.348	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
20	P10855	4.74e-15	66.2	92	0.354	0.380	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	5.4e-18	76.2	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000009184

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000016197	0.983	Chemokine (C-C motif) receptor 2
2	9601.ENSPPYP00000016199	0.980	C-C chemokine receptor type 5
3	9601.ENSPPYP00000015589	0.948	Chemokine (C-C motif) receptor 3
4	9601.ENSPPYP00000022905	0.913	Chemokine (C-X-C motif) receptor 3
5	9601.ENSPPYP00000009183	0.878	Acts as a ligand for C-C chemokine receptor CCR2 (By similarity). Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions (By similarity). Exhibits a chemotactic activity for monocytes and basophils but not neutrophils or eosinophils (By similarity). Plays an important role in mediating peripheral nerve injury-induced neuropathic pain (By similarity). Increases NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, which may be caused by MAPK/ERK-dependent phosphorylatio [...]
6	9601.ENSPPYP00000015703	0.875	Chemokine (C-C motif) receptor 4
7	9601.ENSPPYP00000015784	0.874	Atypical chemokine receptor 4
8	9601.ENSPPYP00000009185	0.870	Chemokine (C-C motif) ligand 7
9	9601.ENSPPYP00000021419	0.869	Chemokine (C-C motif) ligand 27
10	9601.ENSPPYP00000014311	0.866	Chemokine (C-X-C motif) receptor 4
11	9601.ENSPPYP00000016587	0.847	Chemokine (C-X-C motif) ligand 10
12	9601.ENSPPYP00000015590	0.808	Chemokine (C motif) receptor 1
13	9601.ENSPPYP00000015653	0.803	Chemokine (C-C motif) receptor 8
14	9601.ENSPPYP00000009505	0.770	Chemokine (C-C motif) receptor 7
15	9601.ENSPPYP00000019228	0.758	Belongs to the G-protein coupled receptor 1 family.
16	9601.ENSPPYP00000015593	0.756	Chemokine (C-C motif) receptor 9
17	9601.ENSPPYP00000004517	0.752	Chemokine (C-X-C motif) receptor 5
18	9601.ENSPPYP00000015654	0.749	Chemokine (C-X3-C motif) receptor 1
19	9601.ENSPPYP00000014705	0.747	Chemokine (C-X-C motif) receptor 2
20	9601.ENSPPYP00000014707	0.728	Chemokine (C-X-C motif) receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0048020	0.968	CCR chemokine receptor binding
GO:0003824	0.322	catalytic activity
GO:0016740	0.308	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0023052	0.990	signaling
GO:0002376	0.990	immune system process
GO:0009605	0.990	response to external stimulus
GO:0050794	0.986	regulation of cellular process
GO:0040011	0.983	locomotion
GO:0007154	0.983	cell communication
GO:0051716	0.983	cellular response to stimulus
GO:0042221	0.980	response to chemical
GO:0006952	0.976	defense response
GO:0048518	0.964	positive regulation of biological process
GO:0042330	0.959	taxis
GO:0006935	0.953	chemotaxis
GO:0048522	0.897	positive regulation of cellular process
GO:0007165	0.886	signal transduction
GO:0006959	0.881	humoral immune response
GO:0001906	0.876	cell killing
GO:0048878	0.861	chemical homeostasis
GO:0007267	0.829	cell-cell signaling
GO:0061844	0.826	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0030003	0.816	intracellular monoatomic cation homeostasis
GO:0050900	0.732	leukocyte migration
GO:0055074	0.694	calcium ion homeostasis
GO:0048583	0.681	regulation of response to stimulus
GO:0070887	0.678	cellular response to chemical stimulus
GO:0006874	0.646	intracellular calcium ion homeostasis
GO:0060326	0.595	cell chemotaxis
GO:0030595	0.522	leukocyte chemotaxis
GO:0032501	0.500	multicellular organismal process
GO:0048519	0.498	negative regulation of biological process
GO:0006954	0.483	inflammatory response
GO:0002684	0.457	positive regulation of immune system process
GO:0048584	0.448	positive regulation of response to stimulus
GO:0048523	0.445	negative regulation of cellular process
GO:0032101	0.424	regulation of response to external stimulus
GO:2000147	0.420	positive regulation of cell motility
GO:0030335	0.413	positive regulation of cell migration
GO:0010033	0.410	response to organic substance
GO:0031640	0.400	killing of cells of another organism
GO:0071310	0.387	cellular response to organic substance
GO:0042127	0.382	regulation of cell population proliferation
GO:0019222	0.372	regulation of metabolic process
GO:0032103	0.368	positive regulation of response to external stimulus
GO:0034097	0.367	response to cytokine
GO:0051239	0.363	regulation of multicellular organismal process
GO:0071345	0.336	cellular response to cytokine stimulus
GO:0048856	0.327	anatomical structure development
GO:0051179	0.319	localization
GO:0002685	0.319	regulation of leukocyte migration
GO:0071674	0.318	mononuclear cell migration
GO:0009893	0.316	positive regulation of metabolic process
GO:0007166	0.315	cell surface receptor signaling pathway
GO:0060255	0.311	regulation of macromolecule metabolic process
GO:0051240	0.306	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0016020	0.492	membrane
GO:0005886	0.460	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.308	Transferases.

[back to server]