StarFunc result for job id P80098

User Input

>input (99 residues)
MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP
REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P80098	1.000	1.000	1.687E-19	99	1.000	1.000	P80098.pdb.gz	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
2	AFDB:P13500	0.808	0.808	2.746E-15	99	0.737	0.737	P13500.pdb.gz	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
3	AFDB:P51671	0.810	0.825	4.261E-14	97	0.687	0.701	P51671.pdb.gz	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
4	AFDB:P80075	0.711	0.711	7.779E-14	99	0.646	0.646	P80075.pdb.gz	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
5	AFDB:Q99616	0.869	0.877	3.169E-13	98	0.626	0.633	Q99616.pdb.gz	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
6	AFDB:D4ABS1	0.768	0.774	5.410E-13	98	0.606	0.612	D4ABS1.pdb.gz	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
7	AFDB:P48298	0.776	0.790	7.070E-13	97	0.545	0.557	P48298.pdb.gz	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
8	AFDB:P10148	0.746	0.525	1.475E-12	148	0.515	0.345	P10148.pdb.gz	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
9	AFDB:P14844	0.693	0.479	2.519E-12	148	0.505	0.338	P14844.pdb.gz	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
10	PDB:1bo0A	0.596	0.756	2.551E-12	76	0.768	1.000	1bo0A.pdb.gz
11	AFDB:Q9QXY8	0.691	0.704	4.023E-12	97	0.586	0.598	Q9QXY8.pdb.gz	CCL7_RAT C-C motif chemokine 7 OS=Rattus norvegicus OX=10116 GN=Ccl7 PE=3 SV=1
12	PDB:1esrA	0.681	0.872	6.569E-10	76	0.434	0.566	1esrA.pdb.gz
13	PDB:1domA	0.640	0.818	1.567E-9	76	0.545	0.711	1domA.pdb.gz
14	PDB:2ra4B	0.563	0.844	1.424E-8	65	0.384	0.585	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
15	PDB:2mpmA	0.541	0.694	2.972E-8	74	0.475	0.635	2mpmA.pdb.gz	Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
16	PDB:4zltF	0.563	0.881	4.314E-7	62	0.253	0.403	4zltF.pdb.gz
17	PDB:5yamA	0.550	0.766	7.876E-7	69	0.212	0.304	5yamA.pdb.gz
18	PDB:2q8tB	0.558	0.839	1.029E-6	65	0.222	0.338	2q8tB.pdb.gz
19	PDB:1nr4E	0.633	0.891	1.644E-6	69	0.212	0.304	1nr4E.pdb.gz
20	PDB:1g2sA	0.546	0.738	2.625E-6	71	0.293	0.408	1g2sA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P80098	2.89e-70	206	99	1.000	1.000	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
2	P13500	8.30e-40	129	99	0.737	0.737	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
3	Q99616	1.01e-39	129	98	0.636	0.643	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
4	Q62401	4.70e-36	120	104	0.586	0.558	CCL12_MOUSE C-C motif chemokine 12 OS=Mus musculus OX=10090 GN=Ccl12 PE=2 SV=1
5	P51671	3.10e-35	117	97	0.687	0.701	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
6	P80075	7.14e-34	114	99	0.646	0.646	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
7	Q9QXY8	3.33e-33	112	97	0.596	0.608	CCL7_RAT C-C motif chemokine 7 OS=Rattus norvegicus OX=10116 GN=Ccl7 PE=3 SV=1
8	P10148	1.62e-32	112	148	0.505	0.338	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
9	P48298	2.61e-32	110	97	0.556	0.567	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
10	P14844	6.62e-32	110	148	0.505	0.338	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
11	D4ABS1	1.18e-29	103	98	0.485	0.490	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
12	P97545	3.03e-26	95.1	97	0.475	0.485	CCL11_RAT Eotaxin OS=Rattus norvegicus OX=10116 GN=Ccl11 PE=3 SV=1
13	Q9Z121	6.81e-26	94.0	97	0.455	0.464	CCL8_MOUSE C-C motif chemokine 8 OS=Mus musculus OX=10090 GN=Ccl8 PE=3 SV=1
14	Q03366	1.77e-24	90.5	97	0.616	0.629	CCL7_MOUSE C-C motif chemokine 7 OS=Mus musculus OX=10090 GN=Ccl7 PE=3 SV=1
15	P13236	1.84e-19	77.4	92	0.354	0.380	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
16	P16619	1.95e-18	75.1	93	0.343	0.366	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
17	P30882	2.77e-18	74.7	91	0.364	0.396	CCL5_MOUSE C-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Ccl5 PE=1 SV=2
18	P50230	4.20e-17	71.6	92	0.343	0.370	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
19	P50229	8.53e-17	70.9	92	0.354	0.380	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
20	O00175	2.96e-16	70.1	119	0.354	0.294	CCL24_HUMAN C-C motif chemokine 24 OS=Homo sapiens OX=9606 GN=CCL24 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	2.9e-19	80.3	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367832

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292301	0.999	C-C chemokine receptor type 2
2	9606.ENSP00000296140	0.998	C-C chemokine receptor type 1
3	9606.ENSP00000441600	0.997	C-C chemokine receptor type 3
4	9606.ENSP00000292303	0.987	C-C chemokine receptor type 5
5	9606.ENSP00000295683	0.897	C-X-C chemokine receptor type 1
6	9606.ENSP00000416996	0.883	Atypical chemokine receptor 2
7	9606.ENSP00000370542	0.872	Syndecan-1
8	9606.ENSP00000362795	0.863	C-X-C chemokine receptor type 3
9	9606.ENSP00000305651	0.850	C-X-C motif chemokine 10
10	9606.ENSP00000306512	0.842	Interleukin-8
11	9606.ENSP00000379110	0.826	Growth-regulated alpha protein
12	9606.ENSP00000319635	0.825	C-X-C chemokine receptor type 2
13	9606.ENSP00000308815	0.823	C-C motif chemokine 19
14	9606.ENSP00000226317	0.819	C-X-C motif chemokine 6
15	9606.ENSP00000386884	0.814	C-X-C chemokine receptor type 4
16	9606.ENSP00000246657	0.808	C-C chemokine receptor type 7
17	9606.ENSP00000296027	0.803	C-X-C motif chemokine 5
18	9606.ENSP00000385675	0.801	Interleukin-6
19	9606.ENSP00000351059	0.799	CX3C chemokine receptor 1
20	9606.ENSP00000263341	0.788	Interleukin-1 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0048020	0.999	CCR chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0051716	0.995	cellular response to stimulus
GO:0007154	0.994	cell communication
GO:0002376	0.993	immune system process
GO:0042221	0.993	response to chemical
GO:0023052	0.992	signaling
GO:0050794	0.992	regulation of cellular process
GO:0048518	0.989	positive regulation of biological process
GO:0040011	0.980	locomotion
GO:0009605	0.979	response to external stimulus
GO:0042592	0.977	homeostatic process
GO:0006950	0.976	response to stress
GO:0007165	0.970	signal transduction
GO:0048522	0.967	positive regulation of cellular process
GO:0006952	0.961	defense response
GO:0006935	0.945	chemotaxis
GO:0055074	0.939	calcium ion homeostasis
GO:0070887	0.926	cellular response to chemical stimulus
GO:0030334	0.914	regulation of cell migration
GO:0019725	0.902	cellular homeostasis
GO:0030595	0.901	leukocyte chemotaxis
GO:0030003	0.871	intracellular monoatomic cation homeostasis
GO:0006874	0.859	intracellular calcium ion homeostasis
GO:0002685	0.840	regulation of leukocyte migration
GO:0050793	0.836	regulation of developmental process
GO:0007267	0.783	cell-cell signaling
GO:0071621	0.729	granulocyte chemotaxis
GO:0071675	0.709	regulation of mononuclear cell migration
GO:0048583	0.703	regulation of response to stimulus
GO:0040017	0.656	positive regulation of locomotion
GO:0071840	0.641	cellular component organization or biogenesis
GO:2000147	0.634	positive regulation of cell motility
GO:0016043	0.628	cellular component organization
GO:0006955	0.626	immune response
GO:0022603	0.616	regulation of anatomical structure morphogenesis
GO:0030335	0.613	positive regulation of cell migration
GO:0032101	0.581	regulation of response to external stimulus
GO:0044419	0.575	biological process involved in interspecies interaction between organisms
GO:0002684	0.560	positive regulation of immune system process
GO:0048584	0.488	positive regulation of response to stimulus
GO:0032501	0.479	multicellular organismal process
GO:0048519	0.477	negative regulation of biological process
GO:0048523	0.447	negative regulation of cellular process
GO:0006954	0.440	inflammatory response
GO:0019222	0.434	regulation of metabolic process
GO:0051707	0.429	response to other organism
GO:0042127	0.428	regulation of cell population proliferation
GO:0010033	0.419	response to organic substance
GO:0008360	0.416	regulation of cell shape
GO:0050920	0.404	regulation of chemotaxis
GO:0051239	0.375	regulation of multicellular organismal process
GO:0032103	0.368	positive regulation of response to external stimulus
GO:0071310	0.362	cellular response to organic substance
GO:0048856	0.360	anatomical structure development
GO:0007010	0.345	cytoskeleton organization
GO:0060255	0.321	regulation of macromolecule metabolic process
GO:0007166	0.321	cell surface receptor signaling pathway
GO:0002687	0.320	positive regulation of leukocyte migration
GO:0009893	0.308	positive regulation of metabolic process
GO:0051240	0.305	positive regulation of multicellular organismal process
GO:0006959	0.302	humoral immune response
GO:0008284	0.302	positive regulation of cell population proliferation
GO:0071345	0.301	cellular response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0071944	0.523	cell periphery
GO:0005886	0.423	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]