StarFunc result for job id P80192

User Input

>input (1104 residues)
MEPSRALLGCLASAAAAAPPGEDGAGAGAEEEEEEEEEAAAAVGPGELGCDAPLPYWTAV
FEYEAAGEDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSR
CQPGGEDPSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDED
ISQTIENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPD
ILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLARE
WHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYG
VAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFH
CLQDNWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDIL
ERELNIIIHQLCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRK
SLINSRSSPPASPTIIPRLRAIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWG
PGTLGQKELASGDEGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLVKGP
RSSPALPGFTSLMEMEDEDSEGPGSGESRLQHSPSQSYLCIPFPRGEDGDGPSSDGIHEE
PTPVNSATSTPQLTPTNSLKRGGAHHRRCEVALLGCGAVLAATGLGFDLLEAGKCQLLPL
EEPEPPAREEKKRREGLFQRSSRPRRSTSPPSRKLFKKEEPMLLLGDPSASLTLLSLSSI
SECNSTRSLLRSDSDEIVVYEMPVSPVEAPPLSPCTHNPLVNVRVERFKRDPNQSLTPTH
VTLTTPSQPSSHRRTPSDGALKPETLLASRSPSSNGLSPSPGAGMLKTPSPSRDPGEFPR
LPDPNVVFPPTPRRWNTQQDSTLERPKTLEFLPRPRPSANRQRLDPWWFVSPSHARSTSP
ANSSSTETPSNLDSCFASSSSTVEERPGLPALLPFQAGPLPPTERTLLDLDAEGQSQDST
VPLCRAELNTHRPAPYEIQQEFWS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JUN9	0.417	0.427	0.000	1077	0.928	0.951	A0A0G2JUN9.pdb.gz	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
2	AFDB:P80192	1.000	1.000	0.000	1104	1.000	1.000	P80192.pdb.gz	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
3	AFDB:Q5TCX8	0.397	0.419	1.530E-81	1036	0.476	0.507	Q5TCX8.pdb.gz	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
4	AFDB:Q95UN8	0.339	0.324	2.547E-56	1161	0.315	0.300	Q95UN8.pdb.gz	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
5	AFDB:A0A0K3AV08	0.252	0.262	4.346E-32	1059	0.214	0.223	A0A0K3AV08.pdb.gz	MLK1_CAEEL Mitogen-activated protein kinase kinase kinase mlk-1 OS=Caenorhabditis elegans OX=6239 GN=mlk-1 PE=1 SV=1
6	AFDB:F7BN18	0.223	0.218	2.354E-25	1128	0.206	0.201	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
7	AFDB:E9PT20	0.225	0.218	2.715E-24	1143	0.188	0.181	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
8	AFDB:A0A024R8E2	0.225	0.220	3.208E-24	1130	0.204	0.199	A0A024R8E2.pdb.gz
9	AFDB:P42684	0.221	0.207	4.006E-24	1182	0.203	0.190	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
10	PDB:2h8hA	0.222	0.528	6.293E-22	445	0.102	0.254	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
11	PDB:1k9aB	0.215	0.522	6.340E-20	441	0.099	0.247	1k9aB.pdb.gz
12	PDB:4k2rA	0.212	0.413	3.550E-19	551	0.086	0.172	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	AFDB:Q9I7F7	0.225	0.187	2.103E-18	1337	0.176	0.145	Q9I7F7.pdb.gz	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
14	PDB:4fl2A	0.219	0.419	3.101E-18	555	0.086	0.171	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
15	PDB:4btfA	0.209	0.515	6.236E-17	413	0.062	0.167	4btfA.pdb.gz
16	PDB:6s73A	0.210	0.796	4.361E-16	269	0.069	0.283	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:6lk5A	0.212	0.799	4.611E-16	265	0.061	0.253	6lk5A.pdb.gz
18	PDB:7mfdA	0.213	0.551	6.087E-16	410	0.082	0.222	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
19	PDB:3uc4A	0.197	0.650	3.225E-15	295	0.072	0.268	3uc4A.pdb.gz
20	PDB:8bfsA	0.211	0.753	4.501E-15	274	0.063	0.255	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUN9	0.0	1964	1078	0.928	0.950	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
2	D3ZG83	0.0	952	940	0.514	0.603	M3K10_RAT Mitogen-activated protein kinase kinase kinase 10 OS=Rattus norvegicus OX=10116 GN=Map3k10 PE=1 SV=3
3	F1LRA7	0.0	2029	1100	0.948	0.952	F1LRA7_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
4	P80192	0.0	2247	1104	1.000	1.000	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
5	Q02779	0.0	951	954	0.522	0.604	M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens OX=9606 GN=MAP3K10 PE=1 SV=3
6	Q16584	0.0	691	847	0.314	0.410	M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens OX=9606 GN=MAP3K11 PE=1 SV=1
7	Q5TCX8	0.0	845	1036	0.490	0.522	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
8	Q66HA1	0.0	692	850	0.312	0.406	M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus OX=10116 GN=Map3k11 PE=1 SV=1
9	Q66L42	0.0	957	940	0.515	0.605	M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus OX=10090 GN=Map3k10 PE=1 SV=2
10	Q7T2V3	0.0	1046	1005	0.530	0.582	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
11	Q80XI6	0.0	694	850	0.315	0.409	M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus OX=10090 GN=Map3k11 PE=1 SV=1
12	Q95UN8	9.04e-168	527	1161	0.254	0.241	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
13	Q12852	1.53e-72	261	859	0.130	0.166	M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens OX=9606 GN=MAP3K12 PE=1 SV=2
14	Q60700	4.73e-72	260	888	0.130	0.161	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
15	Q1HKZ5	2.36e-68	250	959	0.135	0.155	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
16	O43283	3.87e-68	249	966	0.136	0.155	M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens OX=9606 GN=MAP3K13 PE=1 SV=1
17	D4Q8H0	6.70e-67	234	455	0.122	0.297	D4Q8H0_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=pk PE=1 SV=1
18	Q9NYL2	3.63e-65	238	800	0.122	0.169	M3K20_HUMAN Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20 PE=1 SV=3
19	Q9VW24	1.42e-64	239	977	0.125	0.141	Q9VW24_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=wnd PE=2 SV=1
20	Q9ESL4	1.54e-64	236	802	0.121	0.167	M3K20_MOUSE Mitogen-activated protein kinase kinase kinase 20 OS=Mus musculus OX=10090 GN=Map3k20 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	3	18.5	ABC1 atypical kinase-like domain
2	PF01636 APH	2.2e+02	13.1	Phosphotransferase enzyme family
3	PF00069 Pkinase	4.7e-61	218.0	Protein kinase domain
4	PF17667 Pkinase_fungal	22	15.3	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	5e-60	214.5	Protein tyrosine and serine/threonine kinase
6	PF00018 SH3_1	1.2e-07	42.5	SH3 domain
7	PF07653 SH3_2	3.1e-07	41.4	Variant SH3 domain
8	PF14604 SH3_9	5.3e-10	50.4	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451263

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.944	Cell division control protein 42 homolog
2	9606.ENSP00000410402	0.928	Dual specificity mitogen-activated protein kinase kinase 4
3	9606.ENSP00000348461	0.926	Ras-related C3 botulinum toxin substrate 1
4	9606.ENSP00000468348	0.914	Dual specificity mitogen-activated protein kinase kinase 6
5	9606.ENSP00000300128	0.708	Transmembrane protein 194A
6	9606.ENSP00000377566	0.704	Engulfment and cell motility protein 3
7	9606.ENSP00000348168	0.687	Transcription initiation factor IIE subunit beta
8	9606.ENSP00000260283	0.682	Rho GTPase-activating protein 20
9	9606.ENSP00000284637	0.634	E3 ubiquitin-protein ligase SH3RF1
10	9606.ENSP00000371594	0.602	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
11	9606.ENSP00000401303	0.600	SHC-transforming protein 1
12	9606.ENSP00000302913	0.598	SH3 domain-containing protein 19
13	9606.ENSP00000337850	0.593	KICSTOR complex protein kaptin
14	9606.ENSP00000319412	0.584	Armadillo repeat-containing protein 10
15	9606.ENSP00000394051	0.579	Nostrin
16	9606.ENSP00000363661	0.563	Immunoglobulin-binding protein 1
17	9606.ENSP00000478492	0.543	Cysteinyl leukotriene receptor 1
18	9606.ENSP00000225171	0.516	DnaJ heat shock protein family member C12
19	9606.ENSP00000317332	0.513	Sorting nexin-18
20	9606.ENSP00000360266	0.511	Transcription factor AP-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.998	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0048522	0.978	positive regulation of cellular process
GO:0008219	0.951	cell death
GO:0010941	0.947	regulation of cell death
GO:0010942	0.925	positive regulation of cell death
GO:0043067	0.874	regulation of programmed cell death
GO:0008152	0.796	metabolic process
GO:0071704	0.792	organic substance metabolic process
GO:0042981	0.791	regulation of apoptotic process
GO:0044237	0.778	cellular metabolic process
GO:0044238	0.767	primary metabolic process
GO:0050896	0.746	response to stimulus
GO:0006807	0.671	nitrogen compound metabolic process
GO:0043065	0.664	positive regulation of apoptotic process
GO:0043170	0.648	macromolecule metabolic process
GO:1901564	0.581	organonitrogen compound metabolic process
GO:0006796	0.562	phosphate-containing compound metabolic process
GO:0036211	0.561	protein modification process
GO:0006468	0.549	protein phosphorylation
GO:0019222	0.529	regulation of metabolic process
GO:0048583	0.501	regulation of response to stimulus
GO:0051716	0.409	cellular response to stimulus
GO:0009966	0.398	regulation of signal transduction
GO:0031323	0.394	regulation of cellular metabolic process
GO:0060255	0.377	regulation of macromolecule metabolic process
GO:0080090	0.370	regulation of primary metabolic process
GO:0007154	0.369	cell communication
GO:0051171	0.369	regulation of nitrogen compound metabolic process
GO:0007165	0.359	signal transduction
GO:0006950	0.335	response to stress
GO:0048519	0.329	negative regulation of biological process
GO:0048523	0.315	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.967	organelle
GO:0043229	0.949	intracellular organelle
GO:0005829	0.939	cytosol
GO:0043227	0.864	membrane-bounded organelle
GO:0043231	0.810	intracellular membrane-bounded organelle
GO:0016020	0.674	membrane
GO:0005886	0.359	plasma membrane
GO:0043228	0.305	non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]