StarFunc result for job id P80217

User Input

>input (286 residues)
MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDP
EVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPM
VTTIQMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVM
LGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPD
ILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P80217	1.000	1.000	7.452E-58	286	1.000	1.000	P80217.pdb.gz	IN35_HUMAN Interferon-induced 35 kDa protein OS=Homo sapiens OX=9606 GN=IFI35 PE=1 SV=5
2	AFDB:Q9D8C4	0.692	0.692	1.088E-44	286	0.717	0.717	Q9D8C4.pdb.gz	IN35_MOUSE Interferon-induced 35 kDa protein homolog OS=Mus musculus OX=10090 GN=Ifi35 PE=1 SV=3
3	AFDB:Q13287	0.407	0.384	3.818E-24	307	0.287	0.267	Q13287.pdb.gz	NMI_HUMAN N-myc-interactor OS=Homo sapiens OX=9606 GN=NMI PE=1 SV=2
4	AFDB:O35309	0.422	0.391	7.696E-24	314	0.283	0.258	O35309.pdb.gz	NMI_MOUSE N-myc-interactor OS=Mus musculus OX=10090 GN=Nmi PE=1 SV=1
5	AFDB:Q6ZSC3	0.264	0.214	1.223E-4	357	0.077	0.062	Q6ZSC3.pdb.gz	RBM43_HUMAN RNA-binding protein 43 OS=Homo sapiens OX=9606 GN=RBM43 PE=1 SV=1
6	AFDB:J4C3V8	0.219	0.181	7.924E-4	349	0.066	0.054	J4C3V8.pdb.gz
7	AFDB:Q8TDB6	0.238	0.098	1.001E-3	740	0.080	0.031	Q8TDB6.pdb.gz	DTX3L_HUMAN E3 ubiquitin-protein ligase DTX3L OS=Homo sapiens OX=9606 GN=DTX3L PE=1 SV=1
8	AFDB:E9PNI7	0.215	0.064	1.125E-3	1037	0.133	0.037	E9PNI7.pdb.gz	E9PNI7_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
9	AFDB:Q20870	0.215	0.129	1.693E-3	499	0.070	0.040	Q20870.pdb.gz	DAZ1_CAEEL DAZ protein 1 OS=Caenorhabditis elegans OX=6239 GN=daz-1 PE=2 SV=3
10	AFDB:Q2EMV9	0.239	0.045	1.693E-3	1817	0.122	0.019	Q2EMV9.pdb.gz	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
11	PDB:7ohxo	0.194	0.424	9.551E-3	112	0.059	0.152	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
12	PDB:3lqvB	0.209	0.473	1.206E-2	115	0.052	0.130	3lqvB.pdb.gz	Branch Recognition by SF3b14
13	PDB:3pgwP	0.214	0.486	1.816E-2	113	0.035	0.088	3pgwP.pdb.gz
14	PDB:6ff7X	0.226	0.364	2.432E-2	171	0.056	0.094	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
15	PDB:5xjcw	0.213	0.554	3.660E-2	91	0.070	0.220	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
16	PDB:6c0fo	0.233	0.404	3.660E-2	133	0.101	0.218	6c0fo.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
17	PDB:6exnY	0.222	0.619	3.660E-2	87	0.045	0.149	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
18	PDB:7yziA	0.165	0.136	4.113E-2	378	0.077	0.058	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
19	PDB:5gm6R	0.235	0.255	5.508E-2	261	0.045	0.050	5gm6R.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:7abgA6	0.189	0.559	5.839E-2	74	0.063	0.243	7abgA6.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P80217	0.0	573	286	1.000	1.000	IN35_HUMAN Interferon-induced 35 kDa protein OS=Homo sapiens OX=9606 GN=IFI35 PE=1 SV=5
2	Q9D8C4	7.31e-147	415	286	0.717	0.717	IN35_MOUSE Interferon-induced 35 kDa protein homolog OS=Mus musculus OX=10090 GN=Ifi35 PE=1 SV=3
3	Q13287	1.33e-27	110	307	0.266	0.248	NMI_HUMAN N-myc-interactor OS=Homo sapiens OX=9606 GN=NMI PE=1 SV=2
4	O35309	2.85e-23	99.0	314	0.220	0.201	NMI_MOUSE N-myc-interactor OS=Mus musculus OX=10090 GN=Nmi PE=1 SV=1
5	Q9LHL2	0.002	41.6	358	0.108	0.087	Q9LHL2_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=RBGD3 PE=1 SV=1
6	H0YH80	0.011	38.5	191	0.049	0.073	H0YH80_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1
7	F8W6I7	0.033	37.7	307	0.049	0.046	F8W6I7_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=2
8	A0A2R8Y4L2	0.034	37.4	275	0.049	0.051	RA1L3_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 3 OS=Homo sapiens OX=9606 GN=HNRNPA1L3 PE=4 SV=1
9	A0A024RB53	0.043	37.4	320	0.049	0.044	A0A024RB53_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
10	P49312	0.043	37.4	320	0.049	0.044	ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus OX=10090 GN=Hnrnpa1 PE=1 SV=2
11	Q0VAC0	0.043	37.4	320	0.049	0.044	Q0VAC0_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRPA1 PE=2 SV=1
12	P09651	0.059	37.0	372	0.049	0.038	ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5
13	Q9XFR5	0.068	36.6	268	0.105	0.112	SR30_ARATH Serine/arginine-rich splicing factor SR30 OS=Arabidopsis thaliana OX=3702 GN=SR30 PE=1 SV=1
14	Q7SXQ3	0.071	37.0	388	0.059	0.044	Q7SXQ3_DANRE Heterogeneous nuclear ribonucleoprotein A1 OS=Danio rerio OX=7955 GN=hnrnpa1a PE=1 SV=1
15	F8VZ49	0.073	36.2	231	0.049	0.061	F8VZ49_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1
16	P04256	0.096	36.2	320	0.049	0.044	ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus OX=10116 GN=Hnrnpa1 PE=1 SV=3
17	B4DDB6	0.097	36.2	356	0.049	0.039	B4DDB6_HUMAN Heterogeneous nuclear ribonucleoprotein A3, isoform CRA_a OS=Homo sapiens OX=9606 GN=HNRPA3 PE=2 SV=1
18	A0A384NL63	0.13	36.2	378	0.049	0.037	A0A384NL63_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=HNRPA3 PE=2 SV=1
19	P51991	0.13	36.2	378	0.049	0.037	ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2
20	Q6URK4	0.13	36.2	379	0.049	0.037	ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus OX=10116 GN=Hnrnpa3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07334 IFP_35_N	1.8e-08	45.6	Interferon-induced 35 kDa protein (IFP 35) N-terminus
2	PF07292 NID	3.4e-58	205.4	Nmi/IFP 35 domain (NID)
3	PF01920 Prefoldin_2	1.8e+02	13.5	Prefoldin subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000395590

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360883	0.992	Interferon-induced protein with tetratricopeptide repeats 3
2	9606.ENSP00000368699	0.991	Ubiquitin-like protein ISG15
3	9606.ENSP00000381601	0.990	Interferon-induced GTP-binding protein Mx1
4	9606.ENSP00000388001	0.990	2'-5'-oligoadenylate synthase 1
5	9606.ENSP00000243346	0.989	N-myc-interactor
6	9606.ENSP00000342278	0.989	2'-5'-oligoadenylate synthase 2
7	9606.ENSP00000342513	0.989	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
8	9606.ENSP00000354394	0.989	Signal transducer and activator of transcription 1-alpha/beta
9	9606.ENSP00000360869	0.989	Interferon-induced protein with tetratricopeptide repeats 1
10	9606.ENSP00000228928	0.988	2'-5'-oligoadenylate synthase 3
11	9606.ENSP00000380697	0.988	Interferon regulatory factor 7
12	9606.ENSP00000257570	0.986	2'-5'-oligoadenylate synthase-like protein
13	9606.ENSP00000386187	0.984	Interferon-induced transmembrane protein 1
14	9606.ENSP00000380073	0.983	Interferon regulatory factor 9
15	9606.ENSP00000354822	0.979	XIAP-associated factor 1
16	9606.ENSP00000371471	0.977	Radical S-adenosyl methionine domain-containing protein 2
17	9606.ENSP00000333657	0.976	Interferon-induced GTP-binding protein Mx2
18	9606.ENSP00000306565	0.971	Interferon-stimulated gene 20 kDa protein
19	9606.ENSP00000360891	0.971	Interferon-induced protein with tetratricopeptide repeats 2
20	9606.ENSP00000252593	0.969	Bone marrow stromal antigen 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0009987	0.991	cellular process
GO:0048583	0.990	regulation of response to stimulus
GO:0048522	0.986	positive regulation of cellular process
GO:0002376	0.984	immune system process
GO:1902531	0.980	regulation of intracellular signal transduction
GO:0045089	0.980	positive regulation of innate immune response
GO:0009967	0.979	positive regulation of signal transduction
GO:1901222	0.974	regulation of NIK/NF-kappaB signaling
GO:0050729	0.972	positive regulation of inflammatory response
GO:0006955	0.965	immune response
GO:0048519	0.953	negative regulation of biological process
GO:0048523	0.874	negative regulation of cellular process
GO:0048585	0.870	negative regulation of response to stimulus
GO:0032501	0.706	multicellular organismal process
GO:0002252	0.698	immune effector process
GO:0001775	0.698	cell activation
GO:0002274	0.679	myeloid leukocyte activation
GO:0042116	0.637	macrophage activation
GO:0009968	0.491	negative regulation of signal transduction
GO:0002366	0.321	leukocyte activation involved in immune response
GO:0062207	0.318	regulation of pattern recognition receptor signaling pathway
GO:0002275	0.309	myeloid cell activation involved in immune response
GO:0042127	0.308	regulation of cell population proliferation
GO:0009605	0.306	response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005737	0.990	cytoplasm
GO:0005634	0.987	nucleus
GO:0005829	0.980	cytosol
GO:0016020	0.974	membrane
GO:0070013	0.814	intracellular organelle lumen
GO:0031981	0.361	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]