StarFunc result for job id P80404

User Input

>input (500 residues)
MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYR
SKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BGI0	0.974	0.974	6.124E-96	500	0.966	0.966	Q9BGI0.pdb.gz	GABT_BOVIN 4-aminobutyrate aminotransferase, mitochondrial OS=Bos taurus OX=9913 GN=ABAT PE=2 SV=1
2	AFDB:P50554	0.960	0.960	9.567E-96	500	0.918	0.918	P50554.pdb.gz	GABT_RAT 4-aminobutyrate aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Abat PE=1 SV=3
3	AFDB:H3BNQ7	0.882	0.856	1.332E-88	515	0.922	0.895	H3BNQ7.pdb.gz	H3BNQ7_HUMAN 4-aminobutyrate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ABAT PE=1 SV=1
4	PDB:4y0hD	0.923	0.997	1.641E-87	463	0.884	0.955	4y0hD.pdb.gz	Mechanism of inactivation of gamma-aminobutyric acid aminotransferase by (1S,3S)-3-amino-4-difluoromethylenyl-1-cyclopentanoic acid (CPP-115)
5	AFDB:Q8MYV0	0.903	0.929	8.306E-67	486	0.516	0.531	Q8MYV0.pdb.gz	Q8MYV0_DROME (S)-3-amino-2-methylpropionate transaminase OS=Drosophila melanogaster OX=7227 GN=Gabat PE=2 SV=1
6	AFDB:Q55FI1	0.926	0.935	5.352E-64	495	0.496	0.501	Q55FI1.pdb.gz	GABT_DICDI 4-aminobutyrate aminotransferase OS=Dictyostelium discoideum OX=44689 GN=gabT PE=3 SV=1
7	AFDB:Q21217	0.906	0.938	4.144E-62	483	0.450	0.466	Q21217.pdb.gz	GABT_CAEEL Probable 4-aminobutyrate aminotransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=gta-1 PE=3 SV=1
8	AFDB:P14010	0.904	0.908	7.404E-60	498	0.454	0.456	P14010.pdb.gz	GABAT_EMENI 4-aminobutyrate aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gatA PE=3 SV=1
9	AFDB:A0A1D8PH55	0.887	0.941	3.906E-55	471	0.394	0.418	A0A1D8PH55.pdb.gz	A0A1D8PH55_CANAL 4-aminobutyrate aminotransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UGA1 PE=3 SV=1
10	AFDB:P17649	0.885	0.939	3.842E-54	471	0.386	0.410	P17649.pdb.gz	GABAT_YEAST 4-aminobutyrate aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UGA1 PE=1 SV=2
11	AFDB:O13837	0.894	0.942	1.385E-53	474	0.408	0.430	O13837.pdb.gz	GABAT_SCHPO 4-aminobutyrate aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uga1 PE=1 SV=1
12	PDB:7jh3A	0.739	0.873	1.287E-28	420	0.242	0.288	7jh3A.pdb.gz
13	PDB:1sf2A	0.741	0.866	2.376E-28	425	0.214	0.252	1sf2A.pdb.gz	Crystal structures of unbound and aminooxyacetate-bound Escherichia coli gamma-aminobutyrate aminotransferase.
14	PDB:5h7dA	0.678	0.685	5.934E-26	495	0.204	0.206	5h7dA.pdb.gz	Construction of novel repeat proteins with rigid and predictable structures using a shared helix method.
15	PDB:2byjA	0.679	0.829	1.295E-25	404	0.184	0.228	2byjA.pdb.gz	Determinants of Substrate Specificity in Omega-Aminotransferases.
16	PDB:6torB	0.678	0.831	1.712E-25	404	0.204	0.252	6torB.pdb.gz	Structural characterization of human O-phosphoethanolamine phospho-lyase.
17	PDB:4adbB	0.685	0.842	4.670E-25	401	0.202	0.252	4adbB.pdb.gz	Determination of the Structure of the Catabolic N-Succinylornithine Transaminase (Astc) from Escherichia Coli.
18	PDB:4ppmA	0.691	0.742	1.990E-24	464	0.180	0.194	4ppmA.pdb.gz	Crystal structure of the catalytic domain of PigE: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (MAP) from Serratia sp. FS14
19	PDB:3ntjB	0.621	0.777	2.941E-24	393	0.172	0.219	3ntjB.pdb.gz
20	PDB:1dtyA	0.662	0.765	3.420E-23	429	0.168	0.196	1dtyA.pdb.gz	Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H3BNQ7	0.0	966	515	0.930	0.903	H3BNQ7_HUMAN 4-aminobutyrate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ABAT PE=1 SV=1
2	H3BRN4	0.0	1045	515	1.000	0.971	H3BRN4_HUMAN 4-aminobutyrate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ABAT PE=1 SV=1
3	P50554	0.0	977	500	0.918	0.918	GABT_RAT 4-aminobutyrate aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Abat PE=1 SV=3
4	P61922	0.0	975	500	0.912	0.912	GABT_MOUSE 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1
5	P80147	0.0	1003	500	0.948	0.948	GABT_PIG 4-aminobutyrate aminotransferase, mitochondrial OS=Sus scrofa OX=9823 GN=ABAT PE=1 SV=2
6	P80404	0.0	1046	500	1.000	1.000	GABT_HUMAN 4-aminobutyrate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ABAT PE=1 SV=3
7	Q55FI1	0.0	518	495	0.488	0.493	GABT_DICDI 4-aminobutyrate aminotransferase OS=Dictyostelium discoideum OX=44689 GN=gabT PE=3 SV=1
8	Q8MYV0	0.0	548	486	0.500	0.514	Q8MYV0_DROME (S)-3-amino-2-methylpropionate transaminase OS=Drosophila melanogaster OX=7227 GN=Gabat PE=2 SV=1
9	Q9BGI0	0.0	1001	500	0.966	0.966	GABT_BOVIN 4-aminobutyrate aminotransferase, mitochondrial OS=Bos taurus OX=9913 GN=ABAT PE=2 SV=1
10	Q9VW68	0.0	551	486	0.502	0.516	Q9VW68_DROME (S)-3-amino-2-methylpropionate transaminase OS=Drosophila melanogaster OX=7227 GN=Gabat PE=1 SV=1
11	X5D8S1	0.0	1046	500	1.000	1.000	X5D8S1_HUMAN 4-aminobutyrate aminotransferase, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=ABAT PE=2 SV=1
12	Q21217	4.38e-169	488	483	0.434	0.449	GABT_CAEEL Probable 4-aminobutyrate aminotransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=gta-1 PE=3 SV=1
13	P14010	1.25e-164	477	498	0.460	0.462	GABAT_EMENI 4-aminobutyrate aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gatA PE=3 SV=1
14	O13837	4.73e-137	405	474	0.408	0.430	GABAT_SCHPO 4-aminobutyrate aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uga1 PE=1 SV=1
15	A0A1D8PH55	6.21e-137	405	471	0.396	0.420	A0A1D8PH55_CANAL 4-aminobutyrate aminotransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UGA1 PE=3 SV=1
16	P17649	3.77e-130	388	471	0.392	0.416	GABAT_YEAST 4-aminobutyrate aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UGA1 PE=1 SV=2
17	P50457	2.00e-34	136	421	0.252	0.299	PUUE_ECOLI 4-aminobutyrate aminotransferase PuuE OS=Escherichia coli (strain K12) OX=83333 GN=puuE PE=1 SV=1
18	Q88RB9	1.80e-30	125	425	0.214	0.252	DAVT_PSEPK 5-aminovalerate aminotransferase DavT OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=davT PE=1 SV=1
19	Q9I6M4	1.72e-28	119	426	0.218	0.256	DAVT_PSEAE 5-aminovalerate aminotransferase DavT OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=davT PE=1 SV=1
20	O74548	1.37e-26	114	441	0.222	0.252	ARGD_SCHPO Probable acetylornithine aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	2.9e+02	12.0	Aminotransferase class I and II
2	PF00202 Aminotran_3	8.6e-140	477.6	Aminotransferase class-III
3	PF07401 Lenti_VIF_2	1.8e+02	12.9	Bovine Lentivirus VIF protein
4	PF09371 Tex_N	3.2e+02	12.4	Tex-like protein N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379845

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314649	0.996	Succinate-semialdehyde dehydrogenase, mitochondrial
2	9606.ENSP00000387123	0.986	Alpha-aminoadipic semialdehyde dehydrogenase
3	9606.ENSP00000231420	0.984	Alanine--glyoxylate aminotransferase 2, mitochondrial
4	9606.ENSP00000365437	0.976	Glutamate decarboxylase 2
5	9606.ENSP00000350928	0.974	Glutamate decarboxylase 1
6	9606.ENSP00000366927	0.970	Aldehyde dehydrogenase X, mitochondrial
7	9606.ENSP00000261733	0.966	Aldehyde dehydrogenase, mitochondrial
8	9606.ENSP00000450436	0.962	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
9	9606.ENSP00000307900	0.950	Glutamine synthetase
10	9606.ENSP00000346827	0.945	4-trimethylaminobutyraldehyde dehydrogenase
11	9606.ENSP00000324343	0.941	Beta-ureidopropionase
12	9606.ENSP00000282538	0.939	Acidic amino acid decarboxylase GADL1
13	9606.ENSP00000389009	0.935	Carnosine synthase 1
14	9606.ENSP00000231887	0.929	Peroxisomal bifunctional enzyme
15	9606.ENSP00000255084	0.929	Aldehyde dehydrogenase family 3 member B2
16	9606.ENSP00000345774	0.929	Fatty aldehyde dehydrogenase
17	9606.ENSP00000411821	0.929	Aldehyde dehydrogenase, dimeric NADP-preferring
18	9606.ENSP00000473990	0.929	Aldehyde dehydrogenase family 3 member B1
19	9606.ENSP00000351682	0.926	Carnosine dipeptidase 1
20	9606.ENSP00000325548	0.913	Cytosolic non-specific dipeptidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0036094	0.998	small molecule binding
GO:0043168	0.998	anion binding
GO:1901363	0.997	heterocyclic compound binding
GO:0042802	0.997	identical protein binding
GO:0097159	0.996	organic cyclic compound binding
GO:0003867	0.996	4-aminobutyrate transaminase activity
GO:0070279	0.988	vitamin B6 binding
GO:0030170	0.984	pyridoxal phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0044281	0.997	small molecule metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901564	0.994	organonitrogen compound metabolic process
GO:0019752	0.989	carboxylic acid metabolic process
GO:0006520	0.955	amino acid metabolic process
GO:0032787	0.939	monocarboxylic acid metabolic process
GO:0046395	0.933	carboxylic acid catabolic process
GO:0065007	0.923	biological regulation
GO:0009063	0.901	amino acid catabolic process
GO:0065008	0.446	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.791	intracellular organelle lumen
GO:0005829	0.706	cytosol
GO:0005759	0.328	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23352	0.996	2-oxoglutarate + 4-aminobutanoate = L-glutamate + succinate semialdehyde

[back to server]