StarFunc result for job id P80511

User Input

>input (92 residues)
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQG
LDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P80511	1.000	1.000	4.886E-16	92	1.000	1.000	P80511.pdb.gz	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
2	AFDB:P80310	0.990	0.990	5.056E-13	92	0.707	0.707	P80310.pdb.gz	S10AC_PIG Protein S100-A12 OS=Sus scrofa OX=9823 GN=S100A12 PE=1 SV=2
3	AFDB:P79105	0.987	0.987	3.277E-12	92	0.663	0.663	P79105.pdb.gz	S10AC_BOVIN Protein S100-A12 OS=Bos taurus OX=9913 GN=S100A12 PE=1 SV=3
4	PDB:2wc8D	0.767	0.760	1.260E-11	93	0.989	0.978	2wc8D.pdb.gz	The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
5	AFDB:A0A0S2Z4C5	0.963	0.963	5.785E-9	92	0.380	0.380	A0A0S2Z4C5.pdb.gz	A0A0S2Z4C5_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100B PE=2 SV=1
6	AFDB:P06702	0.962	0.780	9.867E-9	114	0.467	0.377	P06702.pdb.gz	S10A9_HUMAN Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1
7	PDB:5csnA	0.907	0.889	9.980E-9	94	0.370	0.362	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
8	AFDB:P31725	0.961	0.786	1.128E-8	113	0.380	0.310	P31725.pdb.gz	S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3
9	AFDB:A0A060YDS7	0.915	0.887	1.574E-8	95	0.359	0.347	A0A060YDS7.pdb.gz	A0A060YDS7_ONCMY S100 calcium binding protein, beta (neural) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00040819001 PE=4 SV=1
10	PDB:6zdyA	0.898	0.769	2.716E-8	108	0.370	0.315	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
11	AFDB:P29034	0.926	0.872	3.069E-8	98	0.348	0.327	P29034.pdb.gz	S10A2_HUMAN Protein S100-A2 OS=Homo sapiens OX=9606 GN=S100A2 PE=1 SV=3
12	AFDB:Q91061	0.921	0.921	4.008E-8	92	0.413	0.413	Q91061.pdb.gz	S10I_ICTPU Ictacalcin OS=Ictalurus punctatus OX=7998 PE=2 SV=1
13	AFDB:P50116	0.959	0.784	4.581E-8	113	0.370	0.301	P50116.pdb.gz	S10A9_RAT Protein S100-A9 OS=Rattus norvegicus OX=10116 GN=S100a9 PE=1 SV=3
14	PDB:5hloC	0.858	0.849	6.051E-8	93	0.370	0.366	5hloC.pdb.gz	Crystal structure of human S100A8 in complex with zinc and calcium.
15	PDB:7psqG	0.807	0.698	2.809E-7	108	0.359	0.306	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
16	PDB:1k96A	0.824	0.849	3.003E-7	89	0.348	0.360	1k96A.pdb.gz	Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
17	PDB:7ui5A	0.747	0.617	1.220E-6	114	0.446	0.360	7ui5A.pdb.gz	Evolution avoids a pathological stabilizing interaction in the immune protein S100A9.
18	PDB:2k2fA	0.799	0.792	1.490E-6	93	0.391	0.387	2k2fA.pdb.gz	S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
19	PDB:7nmiB	0.888	0.180	3.549E-6	488	0.446	0.084	7nmiB.pdb.gz	Transactivation domain of p53 in complex with S100P using annexin A2 as a crystallization chaperone
20	PDB:2kayA	0.891	0.891	5.663E-6	92	0.337	0.337	2kayA.pdb.gz	Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P80511	4.78e-62	184	92	1.000	1.000	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
2	P80310	1.77e-41	132	92	0.707	0.707	S10AC_PIG Protein S100-A12 OS=Sus scrofa OX=9823 GN=S100A12 PE=1 SV=2
3	P79105	4.41e-39	127	92	0.663	0.663	S10AC_BOVIN Protein S100-A12 OS=Bos taurus OX=9913 GN=S100A12 PE=1 SV=3
4	P06702	1.31e-21	83.6	114	0.467	0.377	S10A9_HUMAN Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1
5	P25815	7.98e-21	80.9	95	0.446	0.432	S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2
6	Q91061	9.88e-21	80.5	92	0.402	0.402	S10I_ICTPU Ictacalcin OS=Ictalurus punctatus OX=7998 PE=2 SV=1
7	W5UM31	3.05e-20	79.3	92	0.402	0.402	W5UM31_ICTPU Protein S100 OS=Ictalurus punctatus OX=7998 GN=S10I PE=2 SV=1
8	Q9PSF6	3.22e-20	79.3	92	0.402	0.402	Q9PSF6_ICTPU Protein S100 OS=Ictalurus punctatus OX=7998 PE=3 SV=1
9	P50114	8.99e-19	75.5	92	0.370	0.370	S100B_MOUSE Protein S100-B OS=Mus musculus OX=10090 GN=S100b PE=1 SV=2
10	P02638	9.92e-19	75.5	92	0.370	0.370	S100B_BOVIN Protein S100-B OS=Bos taurus OX=9913 GN=S100B PE=1 SV=2
11	A0A0S2Z4C5	1.18e-18	75.1	92	0.370	0.370	A0A0S2Z4C5_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100B PE=2 SV=1
12	P04271	1.18e-18	75.1	92	0.370	0.370	S100B_HUMAN Protein S100-B OS=Homo sapiens OX=9606 GN=S100B PE=1 SV=2
13	P04631	2.46e-18	74.3	92	0.359	0.359	S100B_RAT Protein S100-B OS=Rattus norvegicus OX=10116 GN=S100b PE=1 SV=2
14	Q5XJJ5	3.36e-18	74.3	102	0.380	0.343	Q5XJJ5_DANRE Protein S100 OS=Danio rerio OX=7955 GN=zgc:101880 PE=2 SV=1
15	A0A060WZ60	4.91e-18	73.9	96	0.402	0.385	A0A060WZ60_ONCMY Protein S100 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00063160001 PE=3 SV=1
16	P31725	5.44e-17	71.6	113	0.391	0.319	S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3
17	P50116	5.88e-17	71.6	113	0.380	0.310	S10A9_RAT Protein S100-A9 OS=Rattus norvegicus OX=10116 GN=S100a9 PE=1 SV=3
18	A0A060YDS7	2.82e-16	69.3	95	0.337	0.326	A0A060YDS7_ONCMY S100 calcium binding protein, beta (neural) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00040819001 PE=4 SV=1
19	Q8WXG8	3.03e-16	69.3	99	0.413	0.384	S100Z_HUMAN Protein S100-Z OS=Homo sapiens OX=9606 GN=S100Z PE=1 SV=4
20	A0A060YVE5	3.75e-16	68.9	95	0.337	0.326	A0A060YVE5_ONCMY S100 calcium binding protein, beta (neural) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00045272001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.0065	27.0	EF hand
2	PF12763 EF-hand_4	1.3e+02	13.9	Cytoskeletal-regulatory complex EF hand
3	PF13202 EF-hand_5	2.3e+02	12.7	EF hand
4	PF13405 EF-hand_6	0.54	21.3	EF-hand domain
5	PF13499 EF-hand_7	0.15	23.9	EF-hand domain pair
6	PF13833 EF-hand_8	30	15.8	EF-hand domain pair
7	PF10591 SPARC_Ca_bdg	1.7e+02	14.0	Secreted protein acidic and rich in cysteine Ca binding region
8	PF01023 S_100	1.2e-16	71.4	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357726

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364210	0.996	Advanced glycosylation end product-specific receptor
2	9606.ENSP00000357727	0.995	Protein S100-A9
3	9606.ENSP00000357722	0.985	Protein S100-A8
4	9606.ENSP00000229239	0.952	Glyceraldehyde-3-phosphate dehydrogenase
5	9606.ENSP00000296511	0.949	Annexin A5
6	9606.ENSP00000378669	0.941	Fructose-bisphosphate aldolase A
7	9606.ENSP00000390265	0.941	Isocitrate dehydrogenase 1, cytosolic
8	9606.ENSP00000358983	0.906	Nuclear factor NF-kappa-B p100 subunit
9	9606.ENSP00000226574	0.905	Nuclear factor NF-kappa-B p105 subunit
10	9606.ENSP00000384273	0.904	Transcription factor p65
11	9606.ENSP00000363089	0.888	Toll-like receptor 4
12	9606.ENSP00000222286	0.844	Glyceraldehyde-3-phosphate dehydrogenase, testis-specific
13	9606.ENSP00000345347	0.791	High mobility group protein B1
14	9606.ENSP00000331897	0.789	Isocitrate dehydrogenase [NADP], mitochondrial
15	9606.ENSP00000226253	0.787	Belongs to the class I fructose-bisphosphate aldolase family
16	9606.ENSP00000322276	0.771	Vascular non-inflammatory molecule 2
17	9606.ENSP00000362057	0.740	NADPH oxidase 1
18	9606.ENSP00000357712	0.730	S100 calcium binding protein A7
19	9606.ENSP00000384906	0.723	Serum amyloid A-1 protein
20	9606.ENSP00000363988	0.704	Belongs to the class I fructose-bisphosphate aldolase family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	1.000	calcium ion binding
GO:0008270	0.999	zinc ion binding
GO:0005507	0.986	copper ion binding
GO:0042802	0.970	identical protein binding
GO:0005102	0.966	signaling receptor binding
GO:0050786	0.523	RAGE receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0009987	0.984	cellular process
GO:0048518	0.981	positive regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0048522	0.961	positive regulation of cellular process
GO:0019222	0.911	regulation of metabolic process
GO:0032501	0.906	multicellular organismal process
GO:0006954	0.870	inflammatory response
GO:0060255	0.848	regulation of macromolecule metabolic process
GO:0050900	0.821	leukocyte migration
GO:0048583	0.809	regulation of response to stimulus
GO:0019730	0.806	antimicrobial humoral response
GO:0044093	0.804	positive regulation of molecular function
GO:0061844	0.784	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0001775	0.780	cell activation
GO:0080090	0.780	regulation of primary metabolic process
GO:0031323	0.780	regulation of cellular metabolic process
GO:0051171	0.779	regulation of nitrogen compound metabolic process
GO:0042221	0.778	response to chemical
GO:0048584	0.774	positive regulation of response to stimulus
GO:0010468	0.765	regulation of gene expression
GO:1902533	0.763	positive regulation of intracellular signal transduction
GO:0051716	0.758	cellular response to stimulus
GO:0006935	0.758	chemotaxis
GO:0051174	0.745	regulation of phosphorus metabolic process
GO:0043085	0.743	positive regulation of catalytic activity
GO:0042325	0.726	regulation of phosphorylation
GO:0051246	0.725	regulation of protein metabolic process
GO:0009889	0.723	regulation of biosynthetic process
GO:0030595	0.721	leukocyte chemotaxis
GO:0051090	0.714	regulation of DNA-binding transcription factor activity
GO:0009893	0.690	positive regulation of metabolic process
GO:0051091	0.650	positive regulation of DNA-binding transcription factor activity
GO:0002274	0.632	myeloid leukocyte activation
GO:0045859	0.624	regulation of protein kinase activity
GO:0051092	0.621	positive regulation of NF-kappaB transcription factor activity
GO:0080134	0.616	regulation of response to stress
GO:0010604	0.596	positive regulation of macromolecule metabolic process
GO:0071900	0.571	regulation of protein serine/threonine kinase activity
GO:0032103	0.568	positive regulation of response to external stimulus
GO:0043405	0.564	regulation of MAP kinase activity
GO:0097529	0.542	myeloid leukocyte migration
GO:0031347	0.531	regulation of defense response
GO:0008152	0.527	metabolic process
GO:0031325	0.477	positive regulation of cellular metabolic process
GO:0071621	0.472	granulocyte chemotaxis
GO:0007154	0.459	cell communication
GO:1990266	0.458	neutrophil migration
GO:0023052	0.449	signaling
GO:0030593	0.432	neutrophil chemotaxis
GO:0045576	0.430	mast cell activation
GO:0050727	0.420	regulation of inflammatory response
GO:0051173	0.406	positive regulation of nitrogen compound metabolic process
GO:0045937	0.399	positive regulation of phosphate metabolic process
GO:0031349	0.394	positive regulation of defense response
GO:0051347	0.389	positive regulation of transferase activity
GO:0044237	0.355	cellular metabolic process
GO:0051247	0.355	positive regulation of protein metabolic process
GO:0007165	0.350	signal transduction
GO:0010033	0.346	response to organic substance
GO:0009617	0.314	response to bacterium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0012505	0.997	endomembrane system
GO:0005576	0.997	extracellular region
GO:0070013	0.993	intracellular organelle lumen
GO:0031410	0.991	cytoplasmic vesicle
GO:0071944	0.984	cell periphery
GO:0005886	0.971	plasma membrane
GO:0030141	0.956	secretory granule
GO:0005829	0.945	cytosol
GO:0043228	0.920	non-membrane-bounded organelle
GO:0005634	0.917	nucleus
GO:0043232	0.910	intracellular non-membrane-bounded organelle
GO:0005615	0.811	extracellular space
GO:0031983	0.720	vesicle lumen
GO:0034774	0.708	secretory granule lumen
GO:0043230	0.411	extracellular organelle
GO:0065010	0.385	extracellular membrane-bounded organelle
GO:0005856	0.316	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]