StarFunc result for job id P80723

User Input

>input (227 residues)
MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQ
DAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAP
KAAEAAAAPAESAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAA
PSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P80723	1.000	1.000	1.234E-26	227	1.000	1.000	P80723.pdb.gz	BASP1_HUMAN Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2
2	AFDB:P23614	0.111	0.109	1.174E-11	244	0.670	0.623	P23614.pdb.gz	BASP1_CHICK Brain acid soluble protein 1 homolog OS=Gallus gallus OX=9031 GN=BASP1 PE=2 SV=4
3	AFDB:A0A1D8PDR2	0.102	0.066	1.489	367	0.145	0.090	A0A1D8PDR2.pdb.gz	A0A1D8PDR2_CANAL Transcription factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAC1 PE=3 SV=1
4	AFDB:Q8VI64	0.140	0.121	3.947	283	0.198	0.159	Q8VI64.pdb.gz	HUMMR_MOUSE Protein MGARP OS=Mus musculus OX=10090 GN=Mgarp PE=1 SV=1
5	AFDB:Q99PJ2	0.110	0.052	3.947	551	0.159	0.065	Q99PJ2.pdb.gz	TRIM8_MOUSE E3 ubiquitin-protein ligase TRIM8 OS=Mus musculus OX=10090 GN=Trim8 PE=1 SV=3
6	AFDB:Q10728	0.098	0.029	4.255	1032	0.207	0.046	Q10728.pdb.gz	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2
7	AFDB:Q14865	0.114	0.033	5.328	1188	0.181	0.035	Q14865.pdb.gz	ARI5B_HUMAN AT-rich interactive domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ARID5B PE=1 SV=3
8	AFDB:Q9XUS2	0.124	0.074	5.743	441	0.203	0.104	Q9XUS2.pdb.gz	MED29_CAEEL Mediator of RNA polymerase II transcription subunit 29 OS=Caenorhabditis elegans OX=6239 GN=mdt-29 PE=1 SV=1
9	AFDB:Q9NTZ6	0.112	0.038	6.190	932	0.189	0.046	Q9NTZ6.pdb.gz	RBM12_HUMAN RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1
10	AFDB:Q8K1M4	0.135	0.060	6.672	789	0.159	0.046	Q8K1M4.pdb.gz	GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P80723	2.52e-136	383	227	1.000	1.000	BASP1_HUMAN Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2
2	P23614	1.07e-21	91.7	244	0.405	0.377	BASP1_CHICK Brain acid soluble protein 1 homolog OS=Gallus gallus OX=9031 GN=BASP1 PE=2 SV=4
3	Q05175	1.21e-09	58.5	220	0.546	0.564	BASP1_RAT Brain acid soluble protein 1 OS=Rattus norvegicus OX=10116 GN=Basp1 PE=1 SV=2
4	Q91XV3	7.30e-08	53.5	226	0.542	0.544	BASP1_MOUSE Brain acid soluble protein 1 OS=Mus musculus OX=10090 GN=Basp1 PE=1 SV=3
5	U3KQP0	2.72e-05	42.4	45	0.150	0.756	U3KQP0_HUMAN Brain abundant membrane attached signal protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=8
6	Q9JLM4	4.0	31.2	1370	0.070	0.012	ZMYM3_MOUSE Zinc finger MYM-type protein 3 OS=Mus musculus OX=10090 GN=Zmym3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05466 BASP1	1.2e-72	256.3	Brain acid soluble protein 1 (BASP1 protein)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319281

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331327	0.876	Wilms tumor protein
2	9606.ENSP00000478061	0.870	Myristoylated alanine-rich C-kinase substrate
3	9606.ENSP00000362649	0.815	Histone deacetylase 1
4	9606.ENSP00000377372	0.762	Neuromodulin
5	9606.ENSP00000295314	0.758	Tropomodulin-4
6	9606.ENSP00000425093	0.748	Cadherin-18
7	9606.ENSP00000354633	0.722	Transcription initiation factor TFIID subunit 11
8	9606.ENSP00000452552	0.686	Zinc finger protein 37 homolog
9	9606.ENSP00000357863	0.676	General transcription factor 3C polypeptide 6
10	9606.ENSP00000402338	0.671	Ribosome production factor 2 homolog
11	9606.ENSP00000357840	0.666	Sodium-dependent glucose transporter 1
12	9606.ENSP00000450838	0.656	Kallistatin
13	9606.ENSP00000380460	0.655	Phospholipase A-2-activating protein
14	9606.ENSP00000381736	0.623	ATP synthase subunit alpha, mitochondrial
15	9606.ENSP00000349467	0.619	Calmodulin-1
16	9606.ENSP00000357880	0.594	S-adenosylmethionine decarboxylase proenzyme
17	9606.ENSP00000275461	0.591	Fer3-like protein
18	9606.ENSP00000411827	0.573	Integral membrane protein GPR137
19	9606.ENSP00000346671	0.567	Tyrosine-protein kinase Fyn
20	9606.ENSP00000403636	0.556	Ras/Rap GTPase-activating protein SynGAP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	1.000	protein domain specific binding
GO:0003714	1.000	transcription corepressor activity
GO:1901363	0.429	heterocyclic compound binding
GO:0097159	0.429	organic cyclic compound binding
GO:0003676	0.391	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0048856	0.981	anatomical structure development
GO:0010605	0.976	negative regulation of macromolecule metabolic process
GO:0032501	0.973	multicellular organismal process
GO:0031326	0.973	regulation of cellular biosynthetic process
GO:0048523	0.970	negative regulation of cellular process
GO:0051252	0.967	regulation of RNA metabolic process
GO:0010468	0.966	regulation of gene expression
GO:0006355	0.958	regulation of DNA-templated transcription
GO:0007275	0.957	multicellular organism development
GO:0048731	0.937	system development
GO:0031327	0.920	negative regulation of cellular biosynthetic process
GO:0045934	0.915	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.889	negative regulation of DNA-templated transcription
GO:0009987	0.862	cellular process
GO:0048857	0.854	neural nucleus development
GO:0007399	0.854	nervous system development
GO:0060322	0.776	head development
GO:0048513	0.770	animal organ development
GO:0030901	0.362	midbrain development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043229	0.997	intracellular organelle
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0016604	0.985	nuclear body
GO:0005856	0.964	cytoskeleton
GO:0071944	0.948	cell periphery
GO:0016020	0.948	membrane
GO:0140513	0.861	nuclear protein-containing complex
GO:0008180	0.851	COP9 signalosome
GO:0030054	0.821	cell junction
GO:0005886	0.819	plasma membrane
GO:0016363	0.780	nuclear matrix
GO:0016605	0.780	PML body
GO:0031982	0.777	vesicle
GO:0070062	0.745	extracellular exosome
GO:0005829	0.588	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]