StarFunc result for job id P81133

User Input

>input (766 residues)
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGL
GEAWGHSSRTSPLDNVGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPADHDEMTAVLTAHQPYHSHFVQEYEIERSFFLRMKCVLAKRNAGLTCGGY
KVIHCSGYLKIRQYSLDMSPFDGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQDLIEKTLYHHVHGCDTFHLRCAHHLLLVKGQVTTKYYRFLAK
HGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQISASKPAFSYTSSS
TPTMTDNRKGAKSRLSSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLL
DPADRPGSQHDASCAYRQFSDRSSLCYGFALDHSRLVEERHFHTQACEGGRCEAGRYFLG
TPQAGREPWWGSRAALPLTKASPESREAYENSMPHIASVHRIHGRGHWDEDSVVSSPDPG
SASESGDRYRTEQYQSSPHEPSKIETLIRATQQMIKEEENRLQLRKAPSDQLASINGAGK
KHSLCFANYQQPPPTGEVCHGSALANTSPCDHIQQREGKMLSPHENDYDNSPTALSRISS
PNSDRISKSSLILAKDYLHSDISPHQTAGDHPTVSPNCFGSHRQYFDKHAYTLTGYALEH
LYDSETIRNYSLGCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E1C5G3	0.477	0.477	2.356E-102	766	0.916	0.916	E1C5G3.pdb.gz	E1C5G3_CHICK SIM bHLH transcription factor 1 OS=Gallus gallus OX=9031 GN=SIM1 PE=4 SV=1
2	AFDB:Q98SJ5	0.541	0.555	6.704E-87	745	0.725	0.745	Q98SJ5.pdb.gz	SIM1A_DANRE Single-minded homolog 1-A OS=Danio rerio OX=7955 GN=sim1a PE=2 SV=1
3	AFDB:Q14190	0.471	0.539	1.077E-63	667	0.491	0.564	Q14190.pdb.gz	SIM2_HUMAN Single-minded homolog 2 OS=Homo sapiens OX=9606 GN=SIM2 PE=1 SV=2
4	AFDB:Q24167	0.401	0.208	1.497E-33	1507	0.240	0.122	Q24167.pdb.gz	SIMA_DROME Protein similar OS=Drosophila melanogaster OX=7227 GN=sima PE=1 SV=2
5	AFDB:Q9W705	0.145	0.082	2.631E-21	1516	0.209	0.106	Q9W705.pdb.gz	NCOA2_XENLA Nuclear receptor coactivator 2 OS=Xenopus laevis OX=8355 GN=ncoa2 PE=2 SV=1
6	AFDB:O09000	0.151	0.089	6.713E-18	1398	0.196	0.107	O09000.pdb.gz	NCOA3_MOUSE Nuclear receptor coactivator 3 OS=Mus musculus OX=10090 GN=Ncoa3 PE=1 SV=2
7	AFDB:E5L8C8	0.251	0.254	1.253E-15	756	0.164	0.167	E5L8C8.pdb.gz	E5L8C8_CHICK Aryl hydrocarbon receptor repressor OS=Gallus gallus OX=9031 GN=ahrr PE=2 SV=1
8	AFDB:Q8CEE6	0.174	0.106	6.322E-10	1383	0.140	0.077	Q8CEE6.pdb.gz	PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3
9	AFDB:Q96RG2	0.170	0.108	6.882E-9	1323	0.116	0.067	Q96RG2.pdb.gz	PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK PE=1 SV=3
10	PDB:6umzA	0.115	0.590	2.304E-4	127	0.020	0.118	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
11	PDB:2wkpA	0.119	0.264	1.503E-3	320	0.020	0.047	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
12	PDB:7rzwB	0.121	0.108	1.591E-3	864	0.020	0.017	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
13	PDB:5y58B	0.061	0.078	4.064E-2	568	0.037	0.049	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
14	PDB:6hr1A	0.063	0.100	4.553E-2	406	0.043	0.081	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
15	PDB:2bi0A	0.065	0.113	1.267E-1	330	0.031	0.073	2bi0A.pdb.gz
16	PDB:5z10A	0.058	0.042	1.341E-1	1304	0.039	0.023	5z10A.pdb.gz
17	PDB:7bwnJ	0.060	0.106	1.341E-1	280	0.018	0.050	7bwnJ.pdb.gz	Cellular Synthesis and X-ray Crystal Structure of a Designed Protein Heterocatenane.
18	PDB:7wltA	0.057	0.038	1.341E-1	1353	0.031	0.018	7wltA.pdb.gz	Structure deformation and curvature sensing of PIEZO1 in lipid membranes.
19	PDB:8dhbJ	0.067	0.116	1.419E-1	361	0.018	0.039	8dhbJ.pdb.gz	Structural basis for FLCN RagC GAP activation in MiT-TFE substrate-selective mTORC1 regulation.
20	AFDB:Q8IZC6	0.042	0.028	2.763E-1	1860	0.102	0.042	Q8IZC6.pdb.gz	CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens OX=9606 GN=COL27A1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1C5G3	0.0	1454	766	0.916	0.916	E1C5G3_CHICK SIM bHLH transcription factor 1 OS=Gallus gallus OX=9031 GN=SIM1 PE=4 SV=1
2	H7BZX8	0.0	560	480	0.384	0.613	H7BZX8_HUMAN SIM bHLH transcription factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=SIM2 PE=1 SV=1
3	P81133	0.0	1600	766	1.000	1.000	SIM1_HUMAN Single-minded homolog 1 OS=Homo sapiens OX=9606 GN=SIM1 PE=1 SV=2
4	Q14190	0.0	676	667	0.457	0.525	SIM2_HUMAN Single-minded homolog 2 OS=Homo sapiens OX=9606 GN=SIM2 PE=1 SV=2
5	Q61045	0.0	1549	765	0.966	0.967	SIM1_MOUSE Single-minded homolog 1 OS=Mus musculus OX=10090 GN=Sim1 PE=1 SV=3
6	Q61079	0.0	697	657	0.471	0.549	SIM2_MOUSE Single-minded homolog 2 OS=Mus musculus OX=10090 GN=Sim2 PE=1 SV=1
7	Q98SJ5	0.0	1084	745	0.735	0.756	SIM1A_DANRE Single-minded homolog 1-A OS=Danio rerio OX=7955 GN=sim1a PE=2 SV=1
8	P05709	1.40e-168	504	697	0.337	0.370	SIM_DROME Protein single-minded OS=Drosophila melanogaster OX=7227 GN=sim PE=1 SV=3
9	X5D988	5.51e-91	306	903	0.218	0.185	X5D988_HUMAN Neuronal PAS domain protein 3 isoform D (Fragment) OS=Homo sapiens OX=9606 GN=NPAS3 PE=2 SV=1
10	F8VR32	6.51e-91	307	938	0.218	0.178	F8VR32_HUMAN Neuronal PAS domain protein 3 OS=Homo sapiens OX=9606 GN=NPAS3 PE=1 SV=1
11	Q8IXF0	9.38e-91	306	933	0.218	0.179	NPAS3_HUMAN Neuronal PAS domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NPAS3 PE=2 SV=1
12	X5D2Q4	9.38e-91	306	933	0.218	0.179	X5D2Q4_HUMAN Neuronal PAS domain protein 3 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=NPAS3 PE=2 SV=1
13	F8VS42	1.19e-90	306	935	0.218	0.179	F8VS42_HUMAN Neuronal PAS domain protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=NPAS3 PE=1 SV=2
14	Q9QZQ0	1.32e-90	306	925	0.217	0.179	NPAS3_MOUSE Neuronal PAS domain-containing protein 3 OS=Mus musculus OX=10090 GN=Npas3 PE=1 SV=1
15	P97459	1.21e-86	287	594	0.217	0.279	NPAS1_MOUSE Neuronal PAS domain-containing protein 1 OS=Mus musculus OX=10090 GN=Npas1 PE=1 SV=1
16	Q99742	3.19e-84	281	590	0.215	0.280	NPAS1_HUMAN Neuronal PAS domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NPAS1 PE=2 SV=2
17	Q61221	1.94e-82	282	836	0.197	0.181	HIF1A_MOUSE Hypoxia-inducible factor 1-alpha OS=Mus musculus OX=10090 GN=Hif1a PE=1 SV=3
18	A8MYV6	1.33e-81	280	827	0.188	0.174	A8MYV6_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1
19	D0VY79	1.38e-81	280	826	0.188	0.174	D0VY79_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1
20	Q16665	1.38e-81	280	826	0.188	0.174	HIF1A_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	0.01	27.1	Helix-loop-helix DNA-binding domain
2	PF00989 PAS	1.3e-14	65.6	PAS fold
3	PF14598 PAS_11	4.4e-17	73.6	PAS domain
4	PF08447 PAS_3	2.4e-22	90.4	PAS fold
5	PF08448 PAS_4	2	20.1	PAS fold
6	PF13426 PAS_9	0.85	21.3	PAS domain
7	PF06621 SIM_C	5e-114	393.0	Single-minded protein C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358210

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351407	0.920	Aryl hydrocarbon receptor nuclear translocator
2	9606.ENSP00000307479	0.910	Aryl hydrocarbon receptor nuclear translocator 2
3	9606.ENSP00000302814	0.807	Homeobox protein orthopedia
4	9606.ENSP00000299766	0.779	Melanocortin receptor 4
5	9606.ENSP00000250457	0.738	Egl nine homolog 3
6	9606.ENSP00000376077	0.709	Small ubiquitin-related modifier 1
7	9606.ENSP00000217386	0.695	Oxytocin-neurophysin 1
8	9606.ENSP00000329170	0.668	POU domain, class 3, transcription factor 2
9	9606.ENSP00000303452	0.651	Pro-thyrotropin-releasing hormone
10	9606.ENSP00000281806	0.642	Melanin-concentrating hormone receptor 2
11	9606.ENSP00000384092	0.636	Pro-opiomelanocortin
12	9606.ENSP00000290953	0.628	Agouti-related protein
13	9606.ENSP00000276571	0.604	Corticoliberin
14	9606.ENSP00000355601	0.586	Egl nine homolog 1
15	9606.ENSP00000469686	0.574	Egl nine homolog 2
16	9606.ENSP00000243911	0.566	Melanocortin receptor 3
17	9606.ENSP00000261980	0.566	Visual system homeobox 2
18	9606.ENSP00000312652	0.566	Leptin
19	9606.ENSP00000314420	0.565	Period circadian protein homolog 1
20	9606.ENSP00000295206	0.564	Homeobox protein engrailed-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0003677	1.000	DNA binding
GO:0046983	0.993	protein dimerization activity
GO:0043565	0.934	sequence-specific DNA binding
GO:0046982	0.842	protein heterodimerization activity
GO:1990837	0.826	sequence-specific double-stranded DNA binding
GO:0000976	0.641	transcription cis-regulatory region binding
GO:0000981	0.544	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.957	multicellular organismal process
GO:0048731	0.938	system development
GO:0050789	0.928	regulation of biological process
GO:0050794	0.909	regulation of cellular process
GO:0009987	0.787	cellular process
GO:0019222	0.695	regulation of metabolic process
GO:0060255	0.682	regulation of macromolecule metabolic process
GO:0048513	0.674	animal organ development
GO:0007399	0.651	nervous system development
GO:0010468	0.650	regulation of gene expression
GO:0051171	0.643	regulation of nitrogen compound metabolic process
GO:0080090	0.642	regulation of primary metabolic process
GO:0031323	0.616	regulation of cellular metabolic process
GO:0019219	0.580	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.571	regulation of DNA-templated transcription
GO:0048518	0.507	positive regulation of biological process
GO:0035295	0.467	tube development
GO:0050896	0.464	response to stimulus
GO:0001822	0.450	kidney development
GO:0072073	0.439	kidney epithelium development
GO:0048522	0.400	positive regulation of cellular process
GO:0010604	0.337	positive regulation of macromolecule metabolic process
GO:0031325	0.328	positive regulation of cellular metabolic process
GO:0051173	0.316	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043233	0.895	organelle lumen
GO:0070013	0.888	intracellular organelle lumen
GO:0031981	0.814	nuclear lumen
GO:0005654	0.802	nucleoplasm
GO:0016604	0.398	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]