StarFunc result for job id P81172

User Input

>input (84 residues)
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRD
THFPICIFCCGCCHRSKCGMCCKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P81172	1.000	1.000	4.396E-13	84	1.000	1.000	P81172.pdb.gz	HEPC_HUMAN Hepcidin OS=Homo sapiens OX=9606 GN=HAMP PE=1 SV=2
2	AFDB:Q9EQ21	0.279	0.282	2.523E-4	83	0.560	0.566	Q9EQ21.pdb.gz	HEPC_MOUSE Hepcidin OS=Mus musculus OX=10090 GN=Hamp PE=2 SV=1
3	AFDB:Q3YMZ8	0.394	0.351	2.010E-3	96	0.274	0.240	Q3YMZ8.pdb.gz	Q3YMZ8_ICTPU Hepcidin OS=Ictalurus punctatus OX=7998 PE=2 SV=1
4	AFDB:P61516	0.356	0.334	2.690E-2	91	0.321	0.297	P61516.pdb.gz	HEPC1_DANRE Hepcidin-1 OS=Danio rerio OX=7955 GN=hamp1 PE=3 SV=1
5	AFDB:F1QMZ5	0.148	0.021	5.141	1190	0.083	0.006	F1QMZ5.pdb.gz	F1QMZ5_DANRE Zinc finger E-box-binding homeobox 1 isoform X1 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
6	AFDB:Q9LQY1	0.260	0.141	5.853	168	0.143	0.071	Q9LQY1.pdb.gz	Q9LQY1_ARATH T24P13.9 OS=Arabidopsis thaliana OX=3702 GN=At1g26710 PE=4 SV=1
7	PDB:6qfbC	0.107	0.017	7.042	1011	0.107	0.009	6qfbC.pdb.gz	Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.
8	AFDB:A6NLX3	0.160	0.078	7.586	237	0.095	0.034	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
9	AFDB:Q8JFY4	0.239	0.184	8.637	111	0.202	0.153	Q8JFY4.pdb.gz	GHRL_ANGJA Ghrelin OS=Anguilla japonica OX=7937 GN=ghrl PE=1 SV=1
10	PDB:6ahd9	0.300	0.166	9.127	165	0.179	0.091	6ahd9.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
11	AFDB:Q9EQX0	0.281	0.204	9.215	117	0.214	0.154	Q9EQX0.pdb.gz	GHRL_MOUSE Appetite-regulating hormone OS=Mus musculus OX=10090 GN=Ghrl PE=1 SV=1
12	PDB:6qfbB	0.104	0.018	9.739	1035	0.107	0.009	6qfbB.pdb.gz	Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P81172	1.14e-56	170	84	1.000	1.000	HEPC_HUMAN Hepcidin OS=Homo sapiens OX=9606 GN=HAMP PE=1 SV=2
2	Q9EQ21	1.42e-16	69.3	83	0.381	0.386	HEPC_MOUSE Hepcidin OS=Mus musculus OX=10090 GN=Hamp PE=2 SV=1
3	P61516	3.50e-06	43.1	91	0.345	0.319	HEPC1_DANRE Hepcidin-1 OS=Danio rerio OX=7955 GN=hamp1 PE=3 SV=1
4	Q7T273	3.86e-06	43.1	91	0.345	0.319	HEPC2_DANRE Hepcidin-2 OS=Danio rerio OX=7955 GN=hamp2 PE=3 SV=3
5	Q99MH3	4.99e-06	42.4	84	0.345	0.345	HEPC_RAT Hepcidin OS=Rattus norvegicus OX=10116 GN=Hamp PE=3 SV=1
6	Q9DFD6	0.007	33.9	61	0.202	0.279	HEPC_ONCMY Hepcidin (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=hamp PE=2 SV=1
7	F5H212	0.85	30.0	2717	0.202	0.006	F5H212_HUMAN HIVEP zinc finger 1 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=2
8	P15822	0.85	30.0	2718	0.202	0.006	ZEP1_HUMAN Zinc finger protein 40 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=4
9	Q9Y0A1	3.1	28.5	2892	0.143	0.004	ITPR_CAEEL Inositol 1,4,5-trisphosphate receptor itr-1 OS=Caenorhabditis elegans OX=6239 GN=itr-1 PE=1 SV=1
10	Q54F44	6.8	27.3	1142	0.131	0.010	NOXC_DICDI Superoxide-generating NADPH oxidase heavy chain subunit C OS=Dictyostelium discoideum OX=44689 GN=noxC PE=2 SV=1
11	S7VVK4	7.0	27.3	4367	0.190	0.004	GCY_TOXGG Guanylate cyclase OS=Toxoplasma gondii (strain ATCC 50853 / GT1) OX=507601 GN=GC PE=1 SV=1
12	Q91AU0	9.0	26.9	3010	0.143	0.004	Q91AU0_9HEPC Genome polyprotein OS=Hepatitis C virus subtype 1b OX=31647 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06446 Hepcidin	4.4e-18	76.6	Hepcidin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000471894

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261024	0.998	Solute carrier family 40 member 1
2	9606.ENSP00000323929	0.981	Alpha-2-macroglobulin
3	9606.ENSP00000337014	0.917	Hemojuvelin
4	9606.ENSP00000417404	0.915	Hereditary hemochromatosis protein
5	9606.ENSP00000420525	0.910	Transferrin receptor protein 2
6	9606.ENSP00000442304	0.877	Erythroferrone
7	9606.ENSP00000378364	0.876	Natural resistance-associated macrophage protein 2
8	9606.ENSP00000371211	0.873	Transmembrane protease serine 6
9	9606.ENSP00000353224	0.871	Transferrin receptor protein 1
10	9606.ENSP00000252723	0.845	Erythropoietin
11	9606.ENSP00000430620	0.825	Hephaestin
12	9606.ENSP00000319141	0.815	Cytochrome b reductase 1
13	9606.ENSP00000283147	0.800	Bone morphogenetic protein 6
14	9606.ENSP00000296877	0.769	Liver-expressed antimicrobial peptide 2
15	9606.ENSP00000385675	0.757	Interleukin-6
16	9606.ENSP00000255030	0.746	C-reactive protein
17	9606.ENSP00000309477	0.736	Cytoplasmic aconitate hydratase
18	9606.ENSP00000258886	0.731	Iron-responsive element-binding protein 2
19	9606.ENSP00000252809	0.702	Growth differentiation factor 15
20	9606.ENSP00000348170	0.699	Haptoglobin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	1.000	hormone activity
GO:0140678	0.999	molecular function inhibitor activity
GO:0097690	0.918	iron ion transmembrane transporter inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.982	response to stimulus
GO:0055080	0.979	monoatomic cation homeostasis
GO:0098771	0.977	inorganic ion homeostasis
GO:0050794	0.967	regulation of cellular process
GO:0009987	0.958	cellular process
GO:0055072	0.956	iron ion homeostasis
GO:0006950	0.941	response to stress
GO:0048519	0.939	negative regulation of biological process
GO:0009605	0.922	response to external stimulus
GO:0048518	0.906	positive regulation of biological process
GO:0019725	0.897	cellular homeostasis
GO:0048523	0.886	negative regulation of cellular process
GO:0006952	0.876	defense response
GO:0051707	0.863	response to other organism
GO:0006879	0.837	intracellular iron ion homeostasis
GO:0048522	0.802	positive regulation of cellular process
GO:0042221	0.784	response to chemical
GO:0002376	0.765	immune system process
GO:0051239	0.763	regulation of multicellular organismal process
GO:0019222	0.761	regulation of metabolic process
GO:0051171	0.576	regulation of nitrogen compound metabolic process
GO:0009893	0.575	positive regulation of metabolic process
GO:0032501	0.561	multicellular organismal process
GO:0060255	0.555	regulation of macromolecule metabolic process
GO:0080090	0.529	regulation of primary metabolic process
GO:0031323	0.529	regulation of cellular metabolic process
GO:0010604	0.498	positive regulation of macromolecule metabolic process
GO:0031325	0.485	positive regulation of cellular metabolic process
GO:0051173	0.482	positive regulation of nitrogen compound metabolic process
GO:0051716	0.463	cellular response to stimulus
GO:0032879	0.458	regulation of localization
GO:0006955	0.434	immune response
GO:0051049	0.418	regulation of transport
GO:0098542	0.413	defense response to other organism
GO:0009617	0.407	response to bacterium
GO:0051246	0.366	regulation of protein metabolic process
GO:0065009	0.348	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005622	0.928	intracellular anatomical structure
GO:0043226	0.926	organelle
GO:0043231	0.921	intracellular membrane-bounded organelle
GO:0071944	0.813	cell periphery
GO:0005737	0.771	cytoplasm
GO:0016020	0.691	membrane
GO:0005634	0.614	nucleus
GO:0012505	0.387	endomembrane system
GO:0070013	0.349	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]