StarFunc result for job id P81274

User Input

>input (684 residues)
MEENLISMREDHSFHVRYRMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKT
LSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDE
AIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQA
AVDFYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAA
ERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEK
AIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDKSG
ELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTPE
KVQNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKYKTNSSTKVLQDASNSIDHRIPNSQR
KISADTIGDEGFFDLLSRFQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVV
SPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDI
LVKCQGSRLDDQRCAPPPATTKGPTVPDEDFFSLILRSQGKRMDEQRVLLQRDQNRDTDF
GLKDFLQNNALLEFKNSGKKSADH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R0F8	0.638	0.638	4.800E-73	684	1.000	1.000	A0A024R0F8.pdb.gz
2	AFDB:A0A0A0MRC4	0.583	0.565	1.214E-45	707	0.558	0.540	A0A0A0MRC4.pdb.gz	A0A0A0MRC4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
3	AFDB:Q9NFR7	0.558	0.579	9.413E-38	658	0.459	0.477	Q9NFR7.pdb.gz	Q9NFR7_DROME Rapsynoid OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
4	AFDB:Q19955	0.497	0.585	1.509E-23	579	0.266	0.314	Q19955.pdb.gz	Q19955_CAEEL Tetratricopeptide repeat protein 28 OS=Caenorhabditis elegans OX=6239 GN=ags-3 PE=1 SV=1
5	AFDB:Q96AY4	0.348	0.115	3.849E-17	2481	0.184	0.051	Q96AY4.pdb.gz	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
6	AFDB:A5PK42	0.274	0.275	3.371E-12	683	0.155	0.155	A5PK42.pdb.gz	ODAD4_BOVIN Outer dynein arm-docking complex subunit 4 OS=Bos taurus OX=9913 GN=ODAD4 PE=1 SV=1
7	AFDB:Q62018	0.222	0.137	6.546E-10	1173	0.137	0.080	Q62018.pdb.gz	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
8	AFDB:A3KDM3	0.222	0.137	1.132E-9	1160	0.152	0.090	A3KDM3.pdb.gz	A3KDM3_DANRE CTR9 homolog, Paf1/RNA polymerase II complex component OS=Danio rerio OX=7955 GN=fc54a06 PE=1 SV=1
9	AFDB:P14922	0.180	0.145	2.164E-8	966	0.149	0.106	P14922.pdb.gz	CYC8_YEAST General transcriptional corepressor CYC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYC8 PE=1 SV=2
10	AFDB:P73344	0.297	0.443	2.257E-8	429	0.092	0.147	P73344.pdb.gz	P73344_SYNY3 Slr1196 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1196 PE=4 SV=1
11	PDB:7ntfA	0.287	0.227	1.433E-7	918	0.108	0.081	7ntfA.pdb.gz
12	PDB:7dhgC	0.158	0.222	1.338E-6	470	0.091	0.132	7dhgC.pdb.gz
13	PDB:7qe7K	0.203	0.249	2.039E-6	531	0.091	0.117	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	PDB:8a3tJ	0.184	0.240	2.857E-6	509	0.102	0.138	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
15	PDB:7kw7E	0.157	0.316	3.108E-6	327	0.086	0.180	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
16	PDB:7dkhI	0.290	0.224	3.838E-6	914	0.089	0.067	7dkhI.pdb.gz
17	PDB:4gyoB	0.306	0.544	4.175E-6	359	0.073	0.139	4gyoB.pdb.gz	Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
18	PDB:7qe7J	0.258	0.325	4.942E-6	510	0.080	0.108	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:5dseA	0.288	0.351	6.924E-6	537	0.085	0.108	5dseA.pdb.gz
20	PDB:8a3tD	0.343	0.408	8.548E-6	560	0.080	0.098	8a3tD.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRC4	0.0	734	707	0.563	0.545	A0A0A0MRC4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
2	A0A0A0MSK4	0.0	734	675	0.561	0.569	A0A0A0MSK4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=1
3	A0A2R8Y6E3	0.0	623	311	0.440	0.968	A0A2R8Y6E3_HUMAN G protein signaling modulator 2 (Fragment) OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=1
4	H0Y4A4	0.0	1255	627	0.885	0.965	H0Y4A4_HUMAN G protein signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=2
5	P81274	0.0	1422	684	1.000	1.000	GPSM2_HUMAN G-protein-signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=3
6	Q6IR34	0.0	744	673	0.561	0.571	GPSM1_MOUSE G-protein-signaling modulator 1 OS=Mus musculus OX=10090 GN=Gpsm1 PE=1 SV=3
7	Q86YR5	0.0	734	675	0.561	0.569	GPSM1_HUMAN G-protein-signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
8	Q8VDU0	0.0	1265	679	0.914	0.920	GPSM2_MOUSE G-protein-signaling modulator 2 OS=Mus musculus OX=10090 GN=Gpsm2 PE=1 SV=2
9	Q9NFR7	0.0	594	658	0.468	0.486	Q9NFR7_DROME Rapsynoid OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
10	Q9NH88	0.0	592	658	0.465	0.483	Q9NH88_DROME Partner of Inscuteable OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
11	Q9R080	0.0	747	673	0.570	0.579	GPSM1_RAT G-protein-signaling modulator 1 OS=Rattus norvegicus OX=10116 GN=Gpsm1 PE=1 SV=2
12	Q9VB22	0.0	593	658	0.466	0.485	Q9VB22_DROME LD33695p OS=Drosophila melanogaster OX=7227 GN=pins PE=1 SV=1
13	Q19955	4.63e-84	278	579	0.279	0.330	Q19955_CAEEL Tetratricopeptide repeat protein 28 OS=Caenorhabditis elegans OX=6239 GN=ags-3 PE=1 SV=1
14	Q96AY4	7.74e-55	206	2481	0.186	0.051	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
15	F6QN66	8.19e-55	206	2481	0.189	0.052	F6QN66_MACMU Tetratricopeptide repeat domain 28 OS=Macaca mulatta OX=9544 GN=TTC28 PE=4 SV=1
16	A0A2R8Y896	1.65e-51	174	83	0.121	1.000	A0A2R8Y896_HUMAN G-protein-signaling modulator 2 (Fragment) OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=1
17	B0QZC9	6.94e-29	111	52	0.076	1.000	B0QZC9_HUMAN G-protein-signaling modulator 2 (Fragment) OS=Homo sapiens OX=9606 GN=GPSM2 PE=4 SV=1
18	Q8IVA1	1.15e-12	67.8	136	0.050	0.250	PCP2_HUMAN Purkinje cell protein 2 homolog OS=Homo sapiens OX=9606 GN=PCP2 PE=1 SV=2
19	P12660	8.07e-10	59.3	120	0.041	0.233	PCP2_MOUSE Purkinje cell protein 2 OS=Mus musculus OX=10090 GN=Pcp2 PE=1 SV=2
20	Q8QGW4	1.76e-09	62.8	412	0.066	0.109	Q8QGW4_DANRE 43 kDa receptor-associated protein of the synapse OS=Danio rerio OX=7955 GN=rapsyn PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	18	17.0	Anaphase-promoting complex, cyclosome, subunit 3
2	PF02188 GoLoco	9.7e-36	132.1	GoLoco motif
3	PF10579 Rapsyn_N	0.071	24.5	Rapsyn N-terminal myristoylation and linker region
4	PF00515 TPR_1	3.8e-32	120.0	Tetratricopeptide repeat
5	PF13374 TPR_10	9.7e-16	68.3	Tetratricopeptide repeat
6	PF13414 TPR_11	26	15.9	TPR repeat
7	PF13424 TPR_12	2e-35	132.2	Tetratricopeptide repeat
8	PF13428 TPR_14	0.00098	30.7	Tetratricopeptide repeat
9	PF13432 TPR_16	21	17.1	Tetratricopeptide repeat
10	PF13431 TPR_17	9.1	18.0	Tetratricopeptide repeat
11	PF14559 TPR_19	0.68	21.8	Tetratricopeptide repeat
12	PF07719 TPR_2	1.6e-18	76.3	Tetratricopeptide repeat
13	PF07721 TPR_4	1.4e-05	36.2	Tetratricopeptide repeat
14	PF13174 TPR_6	86	15.2	Tetratricopeptide repeat
15	PF13176 TPR_7	4.8e-28	106.1	Tetratricopeptide repeat
16	PF13181 TPR_8	1.4e-17	73.3	Tetratricopeptide repeat
17	PF17874 TPR_MalT	0.018	26.0	MalT-like TPR region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385510

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368872	0.997	Protein inscuteable homolog
2	9606.ENSP00000312999	0.960	Guanine nucleotide-binding protein G(i) subunit alpha-2
3	9606.ENSP00000377298	0.881	Nuclear mitotic apparatus protein 1
4	9606.ENSP00000351618	0.878	Partitioning defective 3 homolog B
5	9606.ENSP00000358867	0.876	Guanine nucleotide-binding protein G(k) subunit alpha
6	9606.ENSP00000262494	0.836	Guanine nucleotide-binding protein G(o) subunit alpha
7	9606.ENSP00000387100	0.836	Taperin
8	9606.ENSP00000321987	0.819	Thrombospondin-type laminin G domain and EAR repeat-containing protein
9	9606.ENSP00000457733	0.815	Calcium-binding mitochondrial carrier protein SCaMC-1
10	9606.ENSP00000466561	0.813	Carcinoembryonic antigen-related cell adhesion molecule 16
11	9606.ENSP00000343027	0.809	Guanine nucleotide-binding protein G(i) subunit alpha-1
12	9606.ENSP00000370057	0.800	FERM and PDZ domain-containing protein 4
13	9606.ENSP00000368808	0.798	Small muscular protein
14	9606.ENSP00000339381	0.766	Regulator of G-protein signaling 12
15	9606.ENSP00000363921	0.751	Partitioning defective 3 homolog
16	9606.ENSP00000300504	0.725	TBC1 domain family member 21
17	9606.ENSP00000296280	0.723	Mannan binding lectin serine peptidase 1
18	9606.ENSP00000300784	0.694	Fructosamine-3-kinase
19	9606.ENSP00000364180	0.689	G-protein-signaling modulator 3
20	9606.ENSP00000352516	0.687	DNA (cytosine-5)-methyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.832	protein domain specific binding
GO:0098772	0.541	molecular function regulator activity
GO:0001965	0.527	G-protein alpha-subunit binding
GO:0030234	0.335	enzyme regulator activity
GO:0005092	0.324	GDP-dissociation inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0048522	0.973	positive regulation of cellular process
GO:1903047	0.951	mitotic cell cycle process
GO:1902850	0.937	microtubule cytoskeleton organization involved in mitosis
GO:0000132	0.922	establishment of mitotic spindle orientation
GO:0032886	0.872	regulation of microtubule-based process
GO:0050896	0.863	response to stimulus
GO:0061842	0.749	microtubule organizing center localization
GO:0023052	0.734	signaling
GO:0007154	0.681	cell communication
GO:0051642	0.668	centrosome localization
GO:0051716	0.659	cellular response to stimulus
GO:0010564	0.562	regulation of cell cycle process
GO:0051493	0.547	regulation of cytoskeleton organization
GO:0090224	0.493	regulation of spindle organization
GO:0007165	0.456	signal transduction
GO:0060341	0.448	regulation of cellular localization
GO:1904375	0.361	regulation of protein localization to cell periphery
GO:0060236	0.348	regulation of mitotic spindle organization
GO:0007051	0.339	spindle organization
GO:0032501	0.310	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0005829	0.993	cytosol
GO:0071944	0.990	cell periphery
GO:0015630	0.985	microtubule cytoskeleton
GO:0005815	0.972	microtubule organizing center
GO:0005813	0.960	centrosome
GO:0005886	0.913	plasma membrane
GO:0032991	0.828	protein-containing complex
GO:0043231	0.767	intracellular membrane-bounded organelle
GO:0005938	0.671	cell cortex
GO:0099568	0.561	cytoplasmic region
GO:0099738	0.344	cell cortex region
GO:0005819	0.317	spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]