StarFunc result for job id P81605

User Input

>input (110 residues)
MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRK
QRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P81605	1.000	1.000	1.245E-15	110	1.000	1.000	P81605.pdb.gz	DCD_HUMAN Dermcidin OS=Homo sapiens OX=9606 GN=DCD PE=1 SV=2
2	AFDB:Q9GZZ8	0.207	0.168	9.100E-1	138	0.282	0.225	Q9GZZ8.pdb.gz	LACRT_HUMAN Extracellular glycoprotein lacritin OS=Homo sapiens OX=9606 GN=LACRT PE=1 SV=1
3	AFDB:O16281	0.356	0.338	9.867E-1	116	0.227	0.216	O16281.pdb.gz	O16281_CAEEL Late embryogenesis abundant protein D-29-like OS=Caenorhabditis elegans OX=6239 GN=CELE_F59A7.2 PE=1 SV=1
4	AFDB:Q6ZMA7	0.372	0.267	4.590	157	0.173	0.121	Q6ZMA7.pdb.gz	PFS16_PLAF7 Parasitophorous vacuole membrane protein S16 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=Pfs16 PE=1 SV=1
5	AFDB:Q5ZMQ7	0.298	0.063	6.344	739	0.127	0.019	Q5ZMQ7.pdb.gz	Q5ZMQ7_CHICK SH3 domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_1g20 PE=1 SV=1
6	AFDB:Q96Q06	0.228	0.032	7.459	1357	0.218	0.018	Q96Q06.pdb.gz	PLIN4_HUMAN Perilipin-4 OS=Homo sapiens OX=9606 GN=PLIN4 PE=1 SV=3
7	AFDB:Q02328	0.361	0.053	9.508	927	0.145	0.017	Q02328.pdb.gz	SLAP2_CAEEL Huntington interacting protein related 1 OS=Caenorhabditis elegans OX=6239 GN=hipr-1 PE=3 SV=3
8	AFDB:Q32M00	0.318	0.290	9.508	123	0.118	0.106	Q32M00.pdb.gz	CRBL2_MOUSE cAMP-responsive element-binding protein-like 2 OS=Mus musculus OX=10090 GN=Crebl2 PE=1 SV=1
9	AFDB:Q9C9Q5	0.433	0.121	9.508	428	0.155	0.040	Q9C9Q5.pdb.gz	RRA2_ARATH Arabinosyltransferase RRA2 OS=Arabidopsis thaliana OX=3702 GN=RRA2 PE=2 SV=1
10	PDB:7nacI	0.157	0.039	9.558	533	0.082	0.017	7nacI.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P81605	1.25e-74	218	110	1.000	1.000	DCD_HUMAN Dermcidin OS=Homo sapiens OX=9606 GN=DCD PE=1 SV=2
2	Q9GZZ8	0.009	35.8	138	0.182	0.145	LACRT_HUMAN Extracellular glycoprotein lacritin OS=Homo sapiens OX=9606 GN=LACRT PE=1 SV=1
3	Q66GN3	0.33	32.0	739	0.173	0.026	NPGR2_ARATH Protein NPGR2 OS=Arabidopsis thaliana OX=3702 GN=NPGR2 PE=1 SV=1
4	Q9SW40	1.4	30.0	567	0.145	0.028	Q9SW40_ARATH Major facilitator superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MFS1 PE=1 SV=1
5	A0A0R4IWM3	2.1	29.6	1278	0.118	0.010	A0A0R4IWM3_DANRE Cyclin G-associated kinase OS=Danio rerio OX=7955 GN=gak PE=1 SV=1
6	O43175	2.7	29.3	533	0.227	0.047	SERA_HUMAN D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4
7	A4GW50	2.8	29.3	464	0.191	0.045	A4GW50_RAT Serine/threonine kinase 38 like OS=Rattus norvegicus OX=10116 GN=Stk38l PE=1 SV=1
8	Q7TSE6	2.8	29.3	464	0.191	0.045	ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus OX=10090 GN=Stk38l PE=1 SV=2
9	Q9Y2H1	2.8	29.3	464	0.191	0.045	ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens OX=9606 GN=STK38L PE=1 SV=3
10	H0Y5Q9	3.1	29.3	810	0.200	0.027	H0Y5Q9_HUMAN Inositol polyphosphate-5-phosphatase D (Fragment) OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=1
11	Q92835	3.1	29.3	1189	0.200	0.019	SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=2
12	A1Z7L9	3.8	28.9	601	0.218	0.040	A1Z7L9_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
13	Q23975	3.9	28.9	601	0.218	0.040	Q23975_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=2 SV=1
14	Q38BV7	4.1	28.9	2693	0.155	0.006	Q38BV7_TRYB2 Calcium channel protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4750 PE=4 SV=1
15	A0A0G2JT94	4.3	28.9	436	0.182	0.046	A0A0G2JT94_RAT Serine/threonine kinase 38 like OS=Rattus norvegicus OX=10116 GN=Stk38l PE=1 SV=1
16	Q61753	5.1	28.5	533	0.236	0.049	SERA_MOUSE D-3-phosphoglycerate dehydrogenase OS=Mus musculus OX=10090 GN=Phgdh PE=1 SV=3
17	F1R019	5.3	28.5	1341	0.136	0.011	F1R019_DANRE Son of sevenless homolog 2 OS=Danio rerio OX=7955 GN=si:ch211-67f24.8 PE=1 SV=2
18	A1Z7L8	5.5	28.5	622	0.218	0.039	A1Z7L8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
19	Q7YU60	5.9	28.5	595	0.218	0.040	Q7YU60_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15291 Dermcidin	8.3e-43	156.4	Dermcidin, antibiotic peptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003807608.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003832390.1	0.653	Serum albumin
2	9597.XP_003804787.1	0.526	Belongs to the pancreatic ribonuclease family.
3	9597.XP_003818474.1	0.516	Cathelicidin antimicrobial peptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005253	1.000	monoatomic anion channel activity
GO:0003723	0.999	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009617	0.987	response to bacterium
GO:0061844	0.986	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0009987	0.978	cellular process
GO:0031640	0.968	killing of cells of another organism
GO:0050829	0.967	defense response to Gram-negative bacterium
GO:0051702	0.892	biological process involved in interaction with symbiont
GO:0050830	0.880	defense response to Gram-positive bacterium
GO:0019731	0.858	antibacterial humoral response
GO:0051873	0.848	killing by host of symbiont cells
GO:0051179	0.643	localization
GO:0009620	0.532	response to fungus
GO:0050832	0.470	defense response to fungus
GO:0006810	0.310	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0016020	0.997	membrane
GO:0070062	0.996	extracellular exosome
GO:0019898	0.992	extrinsic component of membrane
GO:0046930	0.991	pore complex
GO:0005622	0.741	intracellular anatomical structure
GO:0005737	0.696	cytoplasm
GO:0043231	0.660	intracellular membrane-bounded organelle
GO:0070013	0.330	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]