StarFunc result for job id P81877

User Input

>input (361 residues)
MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGF
LHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPP
GFFQPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTP
PRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNY
VGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGM
ESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMS
V

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P81877	0.999	0.999	1.964E-54	361	1.000	1.000	P81877.pdb.gz	SSBP2_HUMAN Single-stranded DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=SSBP2 PE=1 SV=2
2	AFDB:Q9R050	0.350	0.350	2.428E-42	361	0.834	0.834	Q9R050.pdb.gz	SSBP3_RAT Single-stranded DNA-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ssbp3 PE=1 SV=1
3	AFDB:Q9BWW4	0.308	0.290	7.515E-42	388	0.839	0.781	Q9BWW4.pdb.gz	SSBP3_HUMAN Single-stranded DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=SSBP3 PE=1 SV=1
4	AFDB:D0EWT6	0.334	0.332	2.604E-39	364	0.773	0.766	D0EWT6.pdb.gz
5	AFDB:Q9BWG4	0.298	0.281	6.470E-37	385	0.745	0.699	Q9BWG4.pdb.gz	SSBP4_HUMAN Single-stranded DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=SSBP4 PE=1 SV=1
6	AFDB:Q3U4B1	0.251	0.249	2.341E-35	363	0.723	0.719	Q3U4B1.pdb.gz	Q3U4B1_MOUSE Single stranded DNA binding protein 4 OS=Mus musculus OX=10090 GN=Ssbp4 PE=1 SV=1
7	AFDB:A0A2R8Q1W7	0.272	0.247	1.010E-34	399	0.756	0.684	A0A2R8Q1W7.pdb.gz
8	AFDB:P79149	0.079	0.046	1.194E-1	773	0.136	0.063	P79149.pdb.gz	PININ_CANLF Pinin OS=Canis lupus familiaris OX=9615 GN=PNN PE=2 SV=3
9	AFDB:M9PEF2	0.063	0.037	1.665E-1	791	0.183	0.083	M9PEF2.pdb.gz	M9PEF2_DROME Liquid facets, isoform J OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
10	AFDB:Q9P785	0.131	0.108	1.780E-1	451	0.127	0.102	Q9P785.pdb.gz	YNY5_SCHPO LisH domain-containing protein C1711.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1711.05 PE=4 SV=1
11	PDB:7nsba	0.103	0.068	2.395	568	0.025	0.016	7nsba.pdb.gz
12	PDB:6mzcG	0.093	0.072	6.489	473	0.028	0.021	6mzcG.pdb.gz
13	PDB:7ui5A	0.074	0.194	6.489	114	0.047	0.149	7ui5A.pdb.gz	Evolution avoids a pathological stabilizing interaction in the immune protein S100A9.
14	PDB:7egeE	0.094	0.063	6.935	547	0.019	0.013	7egeE.pdb.gz
15	PDB:6nhjz	0.126	0.155	7.412	284	0.030	0.039	6nhjz.pdb.gz
16	PDB:4gouA	0.081	0.060	8.465	507	0.036	0.026	4gouA.pdb.gz
17	PDB:6lk8B	0.078	0.058	8.465	532	0.042	0.028	6lk8B.pdb.gz
18	PDB:7nscA	0.110	0.140	8.465	276	0.044	0.058	7nscA.pdb.gz
19	PDB:5a9q8	0.067	0.056	9.668	434	0.044	0.037	5a9q8.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P81877	0.0	713	361	1.000	1.000	SSBP2_HUMAN Single-stranded DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=SSBP2 PE=1 SV=2
2	Q9CYZ8	0.0	711	361	0.997	0.997	SSBP2_MOUSE Single-stranded DNA-binding protein 2 OS=Mus musculus OX=10090 GN=Ssbp2 PE=1 SV=1
3	Q9R050	0.0	511	361	0.834	0.834	SSBP3_RAT Single-stranded DNA-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ssbp3 PE=1 SV=1
4	Q9BWW4	3.42e-177	499	388	0.839	0.781	SSBP3_HUMAN Single-stranded DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=SSBP3 PE=1 SV=1
5	Q9D032	3.42e-177	499	388	0.839	0.781	SSBP3_MOUSE Single-stranded DNA-binding protein 3 OS=Mus musculus OX=10090 GN=Ssbp3 PE=1 SV=2
6	F1QSQ7	3.35e-163	462	364	0.767	0.761	F1QSQ7_DANRE Single stranded DNA-binding protein 3a OS=Danio rerio OX=7955 GN=SSDP1b PE=4 SV=1
7	Q3U4B1	1.90e-162	460	363	0.717	0.713	Q3U4B1_MOUSE Single stranded DNA binding protein 4 OS=Mus musculus OX=10090 GN=Ssbp4 PE=1 SV=1
8	Q9BWG4	7.64e-161	457	385	0.745	0.699	SSBP4_HUMAN Single-stranded DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=SSBP4 PE=1 SV=1
9	B3DJV4	4.42e-157	448	389	0.745	0.692	B3DJV4_DANRE Single stranded DNA-binding protein 3a OS=Danio rerio OX=7955 GN=ssbp3 PE=2 SV=1
10	A0A2R8QDI9	4.95e-157	448	390	0.745	0.690	A0A2R8QDI9_DANRE Single stranded DNA-binding protein 3a OS=Danio rerio OX=7955 GN=SSDP1b PE=4 SV=1
11	Q9VEB9	2.82e-59	199	445	0.321	0.261	Q9VEB9_DROME Sequence-specific single-stranded DNA-binding protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Ssdp PE=1 SV=1
12	Q8MZ49	3.20e-59	199	445	0.321	0.261	Q8MZ49_DROME GM14473p OS=Drosophila melanogaster OX=7227 GN=Ssdp PE=2 SV=1
13	A0A0B4KGW6	1.13e-58	199	509	0.321	0.228	A0A0B4KGW6_DROME Sequence-specific single-stranded DNA-binding protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Ssdp PE=1 SV=1
14	B7FAS6	2.36e-17	85.1	455	0.177	0.141	SAM10_CAEEL Single-stranded DNA-binding protein homolog sam-10 OS=Caenorhabditis elegans OX=6239 GN=sam-10 PE=2 SV=1
15	O48847	2.67e-08	57.8	787	0.072	0.033	LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana OX=3702 GN=LUH PE=1 SV=1
16	Q9FUY2	4.14e-07	54.3	931	0.066	0.026	LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=2
17	F4JUD2	5.44e-07	53.9	969	0.066	0.025	F4JUD2_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=1
18	O74522	0.20	36.2	964	0.028	0.010	ADN3_SCHPO Adhesion defective protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adn3 PE=3 SV=1
19	E9PTG1	0.25	35.8	1597	0.083	0.019	E9PTG1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1
20	A0A8I6ARN7	0.27	35.8	1579	0.083	0.019	A0A8I6ARN7_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04503 SSDP	7.4e-81	284.2	Single-stranded DNA binding protein, SSDP

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000011041

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001783	0.970	LIM domain binding 1
2	60711.ENSCSAP00000012541	0.853	LIM domain binding 2
3	60711.ENSCSAP00000012766	0.832	ISL LIM homeobox 1
4	60711.ENSCSAP00000012543	0.821	annotation not available
5	60711.ENSCSAP00000016580	0.805	LIM domain only 4
6	60711.ENSCSAP00000010803	0.799	ISL LIM homeobox 2
7	60711.ENSCSAP00000001664	0.776	Single stranded DNA binding protein 4
8	60711.ENSCSAP00000010218	0.775	Uncharacterized protein
9	60711.ENSCSAP00000009499	0.740	annotation not available
10	60711.ENSCSAP00000016711	0.740	annotation not available
11	60711.ENSCSAP00000004366	0.694	Single-stranded DNA binding protein 1, mitochondrial
12	60711.ENSCSAP00000008534	0.693	INTS3 and NABP interacting protein
13	60711.ENSCSAP00000016159	0.671	Integrator complex subunit 3
14	60711.ENSCSAP00000005022	0.649	Serine/threonine/tyrosine kinase 1
15	60711.ENSCSAP00000011815	0.646	LIM homeobox 3
16	60711.ENSCSAP00000012925	0.639	Family with sequence similarity 114, member A1
17	60711.ENSCSAP00000016492	0.639	Chloride channel CLIC-like 1
18	60711.ENSCSAP00000009825	0.637	LIM homeobox transcription factor 1, beta
19	60711.ENSCSAP00000001680	0.630	LIM domain only 2 (rhombotin-like 1)
20	60711.ENSCSAP00000002738	0.601	NSE1 homolog, SMC5-SMC6 complex component

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.965	DNA binding
GO:0003697	0.476	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.995	anatomical structure development
GO:0007275	0.991	multicellular organism development
GO:0009987	0.988	cellular process
GO:0030182	0.967	neuron differentiation
GO:0031175	0.959	neuron projection development
GO:0009653	0.952	anatomical structure morphogenesis
GO:0048858	0.943	cell projection morphogenesis
GO:0000904	0.878	cell morphogenesis involved in differentiation
GO:0050789	0.786	regulation of biological process
GO:0048812	0.703	neuron projection morphogenesis
GO:0019222	0.691	regulation of metabolic process
GO:0060255	0.647	regulation of macromolecule metabolic process
GO:0050794	0.641	regulation of cellular process
GO:0048667	0.571	cell morphogenesis involved in neuron differentiation
GO:0010468	0.556	regulation of gene expression
GO:0007409	0.532	axonogenesis
GO:0019219	0.489	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.463	regulation of macromolecule biosynthetic process
GO:0006355	0.452	regulation of DNA-templated transcription
GO:0006357	0.367	regulation of transcription by RNA polymerase II
GO:0048522	0.302	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0005737	0.989	cytoplasm
GO:0032991	0.980	protein-containing complex
GO:0043232	0.791	intracellular non-membrane-bounded organelle
GO:0043227	0.778	membrane-bounded organelle
GO:0005634	0.751	nucleus
GO:0005667	0.709	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]