StarFunc result for job id P82094

User Input

>input (1093 residues)
MSWFNASQLSSFAKQALSQAQKSIDRVLDIQEEEPSIWAETIPYGEPGISSPVSGGWDTS
TWGLKSNTEPQSPPIASPKAITKPVRRTVVDESENFFSAFLSPTDVQTIQKSPVVSKPPA
KSQRPEEEVKSSLHESLHIGQSRTPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEET
VNKESDMKVPTVSLKVSESVIDVKTTMESISNTSTQSLTAETKDIALEPKEQKHEDRQSN
TPSPPVSTFSSGTSTTSDIEVLDHESVISESSASSRQETTDSKSSLHLMQTSFQLLSASA
CPEYNRLDDFQKLTESCCSSDAFERIDSFSVQSLDSRSVSEINSDDELSGKGYALVPIIV
NSSTPKSKTVESAEGKSEEVNETLVIPTEEAEMEESGRSATPVNCEQPDILVSSTPINEG
QTVLDKVAEQCEPAESQPEALSEKEDVCKTVEFLNEKLEKREAQLLSLSKEKALLEEAFD
NLKDEMFRVKEESSSISSLKDEFTQRIAEAEKKVQLACKERDAAKKEIKNIKEELATRLN
SSETADLLKEKDEQIRGLMEEGEKLSKQQLHNSNIIKKLRAKDKENENMVAKLNKKVKEL
EEELQHLKQVLDGKEEVEKQHRENIKKLNSMVERQEKDLGRLQVDMDELEEKNRSIQAAL
DSAYKELTDLHKANAAKDSEAQEAALSREMKAKEELSAALEKAQEEARQQQETLAIQVGD
LRLALQRTEQAAARKEDYLRHEIGELQQRLQEAENRNQELSQSVSSTTRPLLRQIENLQA
TLGSQTSSWEKLEKNLSDRLGESQTLLAAAVERERAATEELLANKIQMSSMESQNSLLRQ
ENSRFQAQLESEKNRLCKLEDENNRYQVELENLKDEYVRTLEETRKEKTLLNSQLEMERM
KVEQERKKAIFTQETIKEKERKPFSVSSTPTMSRSSSISGVDMAGLQTSFLSQDESHDHS
FGPMPISANGSNLYDAVRMGAGSSIIENLQSQLKLREGEITHLQLEIGNLEKTRSIMAEE
LVKLTNQNDELEEKVKEIPKLRTQLRDLDQRYNTILQMYGEKAEEAEELRLDLEDVKNMY
KTQIDELLRQSLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R370	0.165	0.165	0.000	1093	1.000	1.000	A0A024R370.pdb.gz
2	AFDB:A0A2R8Y7M0	0.127	0.140	0.000	985	0.901	1.000	A0A2R8Y7M0.pdb.gz	A0A2R8Y7M0_HUMAN TATA element modulatory factor 1 OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=1
3	AFDB:B9EKI3	0.278	0.278	0.000	1091	0.873	0.874	B9EKI3.pdb.gz	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
4	AFDB:F4HQB9	0.109	0.121	3.822E-23	976	0.237	0.265	F4HQB9.pdb.gz	F4HQB9_ARATH Golgin Putative 5 OS=Arabidopsis thaliana OX=3702 GN=GC5 PE=1 SV=1
5	AFDB:Q9UPV0	0.086	0.066	4.245E-11	1460	0.171	0.128	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
6	AFDB:Q9UPS8	0.073	0.057	1.435E-10	1710	0.171	0.109	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
7	AFDB:Q5DU05	0.088	0.070	2.736E-10	1446	0.161	0.122	Q5DU05.pdb.gz	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
8	AFDB:Q8TES7	0.091	0.088	8.017E-10	1133	0.169	0.163	Q8TES7.pdb.gz	FBF1_HUMAN Fas-binding factor 1 OS=Homo sapiens OX=9606 GN=FBF1 PE=1 SV=2
9	AFDB:Q4G0X9	0.096	0.093	2.186E-9	1142	0.149	0.143	Q4G0X9.pdb.gz	CCD40_HUMAN Coiled-coil domain-containing protein 40 OS=Homo sapiens OX=9606 GN=CCDC40 PE=1 SV=2
10	AFDB:Q0VF96	0.116	0.100	4.766E-8	1302	0.179	0.151	Q0VF96.pdb.gz	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
11	PDB:6msjA	0.028	0.068	9.681	413	0.005	0.015	6msjA.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y7M0	0.0	1201	985	0.569	0.631	A0A2R8Y7M0_HUMAN TATA element modulatory factor 1 OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=1
2	B9EKI3	0.0	1791	1091	0.870	0.872	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
3	P82094	0.0	2203	1093	1.000	1.000	TMF1_HUMAN TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2
4	F4HQB9	1.57e-39	161	976	0.168	0.189	F4HQB9_ARATH Golgin Putative 5 OS=Arabidopsis thaliana OX=3702 GN=GC5 PE=1 SV=1
5	Q9Y7Y1	4.59e-06	53.1	547	0.035	0.069	SGM1_SCHPO Protein sgm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sgm1 PE=3 SV=1
6	P47166	8.83e-04	45.8	707	0.027	0.042	SGM1_YEAST Protein SGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGM1 PE=1 SV=1
7	A0A8I6AK94	0.023	41.2	1261	0.083	0.072	A0A8I6AK94_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=3 SV=1
8	O75334	0.024	41.2	1257	0.083	0.072	LIPA2_HUMAN Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 PE=1 SV=2
9	Q80WE4	0.028	41.2	1774	0.077	0.047	KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus OX=10090 GN=Kif20b PE=1 SV=3
10	Q54HI5	0.033	40.8	716	0.059	0.089	LMNB1_DICDI Lamin-like protein OS=Dictyostelium discoideum OX=44689 GN=lmnB PE=1 SV=1
11	P49454	0.043	40.4	3114	0.120	0.042	CENPF_HUMAN Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3
12	Q8BSS9	0.052	40.0	1257	0.084	0.073	LIPA2_MOUSE Liprin-alpha-2 OS=Mus musculus OX=10090 GN=Ppfia2 PE=1 SV=2
13	A0A8I6AM56	0.081	39.7	1246	0.082	0.072	A0A8I6AM56_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=3 SV=1
14	F1M8A4	0.10	39.3	1126	0.082	0.080	F1M8A4_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=1 SV=3
15	Q96G01	0.23	38.1	975	0.067	0.075	BICD1_HUMAN Protein bicaudal D homolog 1 OS=Homo sapiens OX=9606 GN=BICD1 PE=1 SV=3
16	O94986	0.38	37.4	1710	0.044	0.028	CE152_HUMAN Centrosomal protein of 152 kDa OS=Homo sapiens OX=9606 GN=CEP152 PE=1 SV=4
17	A6NC98	0.50	37.0	1476	0.064	0.047	CC88B_HUMAN Coiled-coil domain-containing protein 88B OS=Homo sapiens OX=9606 GN=CCDC88B PE=1 SV=1
18	Q9ULD2	0.53	37.0	1270	0.068	0.058	MTUS1_HUMAN Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2
19	Q91Z79	0.64	36.6	1192	0.081	0.075	LIPA3_RAT Liprin-alpha-3 OS=Rattus norvegicus OX=10116 GN=Ppfia3 PE=1 SV=2
20	Q508P8	0.66	36.6	1938	0.070	0.039	Q508P8_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=im:6897999 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02211 NHase_beta	88	14.6	Nitrile hydratase beta subunit
2	PF12329 TMF_DNA_bd	2.5e-18	77.2	TATA element modulatory factor 1 DNA binding
3	PF12325 TMF_TATA_bd	1.8e-28	110.4	TATA element modulatory factor 1 TATA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381567

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311449	0.977	Ras-related protein Rab-6A
2	9606.ENSP00000319781	0.900	Ras-related protein Rab-43
3	9606.ENSP00000285208	0.861	Ras-related protein Rab-6B
4	9606.ENSP00000427882	0.818	Ankyrin and armadillo repeat containing
5	9606.ENSP00000362656	0.769	Golgin subfamily A member 1
6	9606.ENSP00000349305	0.747	Golgin subfamily A member 4
7	9606.ENSP00000363822	0.747	Androgen receptor
8	9606.ENSP00000307939	0.740	GRIP and coiled-coil domain-containing protein 2
9	9606.ENSP00000258654	0.729	Conserved oligomeric Golgi complex subunit 3
10	9606.ENSP00000409952	0.721	Vacuolar protein sorting-associated protein 52 homolog
11	9606.ENSP00000264151	0.720	Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial
12	9606.ENSP00000387307	0.712	Ras-related protein Rab-6C
13	9606.ENSP00000296484	0.702	POC1 centriolar protein homolog A
14	9606.ENSP00000243918	0.699	Protein SYS1 homolog
15	9606.ENSP00000386443	0.694	Trans-Golgi network integral membrane protein 2
16	9606.ENSP00000387122	0.691	Protein CLEC16A
17	9606.ENSP00000272322	0.688	Vacuolar protein sorting-associated protein 54
18	9606.ENSP00000263354	0.681	Alpha-soluble NSF attachment protein
19	9606.ENSP00000482826	0.681	Beta-soluble NSF attachment protein
20	9606.ENSP00000258301	0.679	Syntaxin-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0065007	0.985	biological regulation
GO:0050794	0.979	regulation of cellular process
GO:0050896	0.974	response to stimulus
GO:0019222	0.957	regulation of metabolic process
GO:0051716	0.913	cellular response to stimulus
GO:0007154	0.900	cell communication
GO:0023052	0.899	signaling
GO:0042221	0.886	response to chemical
GO:0060255	0.877	regulation of macromolecule metabolic process
GO:0030522	0.877	intracellular receptor signaling pathway
GO:0051171	0.871	regulation of nitrogen compound metabolic process
GO:0080090	0.869	regulation of primary metabolic process
GO:0048522	0.830	positive regulation of cellular process
GO:0070887	0.828	cellular response to chemical stimulus
GO:0010033	0.823	response to organic substance
GO:0071310	0.813	cellular response to organic substance
GO:0014070	0.770	response to organic cyclic compound
GO:0009889	0.710	regulation of biosynthetic process
GO:0031323	0.664	regulation of cellular metabolic process
GO:0010468	0.660	regulation of gene expression
GO:0051179	0.659	localization
GO:0009719	0.651	response to endogenous stimulus
GO:0071407	0.641	cellular response to organic cyclic compound
GO:0009755	0.618	hormone-mediated signaling pathway
GO:0006810	0.578	transport
GO:0071840	0.512	cellular component organization or biogenesis
GO:0019219	0.505	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.492	regulation of RNA metabolic process
GO:0031326	0.486	regulation of cellular biosynthetic process
GO:0006355	0.480	regulation of DNA-templated transcription
GO:0016043	0.465	cellular component organization
GO:0010604	0.455	positive regulation of macromolecule metabolic process
GO:0043401	0.422	steroid hormone mediated signaling pathway
GO:0030518	0.406	intracellular steroid hormone receptor signaling pathway
GO:0051173	0.325	positive regulation of nitrogen compound metabolic process
GO:0045893	0.319	positive regulation of DNA-templated transcription
GO:0006357	0.310	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0005829	0.948	cytosol
GO:0016020	0.521	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]