StarFunc result for job id P82279

User Input

>input (1406 residues)
MALKNINYLLIFYLSFSLLIYIKNSFCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTA
NNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQ
HGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQG
RHCDLEVDECASDPCKNEATCLNEIGRYTCICPHNYSGVNCELEIDECWSQPCLNGATCQ
DALGAYFCDCAPGFLGDHCELNTDECASQPCLHGGLCVDGENRYSCNCTGSGFTGTHCET
LMPLCWSKPCHNNATCEDSVDNYTCHCWPGYTGAQCEIDLNECNSNPCQSNGECVELSSE
KQYGRITGLPSSFSYHEASGYVCICQPGFTGIHCEEDVNECSSNPCQNGGTCENLPGNYT
CHCPFDNLSRTFYGGRDCSDILLGCTHQQCLNNGTCIPHFQDGQHGFSCLCPSGYTGSLC
EIATTLSFEGDGFLWVKSGSVTTKGSVCNIALRFQTVQPMALLLFRSNRDVFVKLELLSG
YIHLSIQVNNQSKVLLFISHNTSDGEWHFVEVIFAEAVTLTLIDDSCKEKCIAKAPTPLE
SDQSICAFQNSFLGGLPVGMTSNGVALLNFYNMPSTPSFVGCLQDIKIDWNHITLENISS
GSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYVAGRFGQDD
STGYVIFTLDESYGDTISLSMFVRTLQPSGLLLALENSTYQYIRVWLERGRLAMLTPNSP
KLVVKFVLNDGNVHLISLKIKPYKIELYQSSQNLGFISASTWKIEKGDVIYIGGLPDKQE
TELNGGFFKGCIQDVRLNNQNLEFFPNPTNNASLNPVLVNVTQGCAGDNSCKSNPCHNGG
VCHSRWDDFSCSCPALTSGKACEEVQWCGFSPCPHGAQCQPVLQGFECIANAVFNGQSGQ
ILFRSNGNITRELTNITFGFRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQSGNSFYM
LSLTSLQSVNDGTWHEVTLSMTDPLSQTSRWQMEVDNETPFVTSTIATGSLNFLKDNTDI
YVGDRAIDNIKGLQGCLSTIEIGGIYLSYFENVHGFINKPQEEQFLKISTNSVVTGCLQL
NVCNSNPCLHGGNCEDIYSSYHCSCPLGWSGKHCELNIDECFSNPCIHGNCSDRVAAYHC
TCEPGYTGVNCEVDIDNCQSHQCANGATCISHTNGYSCLCFGNFTGKFCRQSRLPSTVCG
NEKTNLTCYNGGNCTEFQTELKCMCRPGFTGEWCEKDIDECASDPCVNGGLCQDLLNKFQ
CLCDVAFAGERCEVDLADDLISDIFTTIGSVTVALLLILLLAIVASVVTSNKRATQGTYS
PSRQEKEGSRVEMWNLMPPPAMERLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZZL8	0.399	0.398	0.000	1407	0.739	0.738	D3ZZL8.pdb.gz	D3ZZL8_RAT Crumbs cell polarity complex component 1 OS=Rattus norvegicus OX=10116 GN=Crb1 PE=4 SV=2
2	AFDB:P82279	1.000	1.000	0.000	1406	1.000	1.000	P82279.pdb.gz	CRUM1_HUMAN Protein crumbs homolog 1 OS=Homo sapiens OX=9606 GN=CRB1 PE=1 SV=2
3	AFDB:Q1A5L2	0.309	0.298	0.000	1466	0.366	0.351	Q1A5L2.pdb.gz	Q1A5L2_DANRE Crb2 OS=Danio rerio OX=7955 GN=crb2 PE=1 SV=1
4	AFDB:Q8VHS2	0.514	0.514	0.000	1405	0.761	0.762	Q8VHS2.pdb.gz	CRUM1_MOUSE Protein crumbs homolog 1 OS=Mus musculus OX=10090 GN=Crb1 PE=1 SV=3
5	AFDB:Q5IJ48	0.329	0.356	8.286E-104	1285	0.307	0.335	Q5IJ48.pdb.gz	CRUM2_HUMAN Protein crumbs homolog 2 OS=Homo sapiens OX=9606 GN=CRB2 PE=1 SV=2
6	AFDB:Q80YA8	0.322	0.349	2.258E-102	1282	0.305	0.335	Q80YA8.pdb.gz	CRUM2_MOUSE Protein crumbs homolog 2 OS=Mus musculus OX=10090 GN=Crb2 PE=1 SV=3
7	AFDB:P10040	0.335	0.235	4.477E-89	2146	0.330	0.216	P10040.pdb.gz	CRB_DROME Protein crumbs OS=Drosophila melanogaster OX=7227 GN=crb PE=1 SV=3
8	AFDB:P21783	0.107	0.065	3.920E-56	2524	0.223	0.124	P21783.pdb.gz	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
9	AFDB:O35516	0.086	0.055	1.357E-55	2473	0.214	0.122	O35516.pdb.gz	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
10	AFDB:F1RCH4	0.115	0.070	2.086E-55	2475	0.225	0.128	F1RCH4.pdb.gz	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
11	PDB:2a3wA	0.102	0.604	4.882E-6	204	0.022	0.152	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
12	PDB:4pbpB	0.105	0.603	1.951E-5	210	0.020	0.133	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
13	PDB:6m5yA	0.062	0.273	2.598E-5	270	0.025	0.130	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
14	PDB:3v0aB	0.084	0.101	2.998E-5	1150	0.025	0.030	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
15	PDB:7ufgB	0.097	0.114	4.394E-5	1182	0.021	0.025	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
16	PDB:7ufgA	0.092	0.111	4.609E-5	1151	0.018	0.023	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:7zl1A	0.100	0.569	8.576E-5	215	0.018	0.121	7zl1A.pdb.gz
18	PDB:7vmlA	0.060	0.027	1.142E-4	4044	0.038	0.013	7vmlA.pdb.gz	Molecular basis for gating of cardiac ryanodine receptor explains the mechanisms for gain- and loss-of function mutations.
19	PDB:1b09A	0.101	0.588	1.198E-4	206	0.015	0.102	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
20	PDB:8a7eC	0.093	0.086	2.026E-4	1524	0.016	0.015	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZKN7	0.0	2097	1336	0.715	0.752	A0A8I5ZKN7_RAT Crumbs cell polarity complex component 1 OS=Rattus norvegicus OX=10116 GN=Crb1 PE=4 SV=1
2	A0A8I6A4M0	0.0	1741	1314	0.617	0.661	A0A8I6A4M0_RAT Crumbs cell polarity complex component 1 OS=Rattus norvegicus OX=10116 GN=Crb1 PE=4 SV=1
3	A0A8I6AQJ2	0.0	1103	760	0.385	0.712	A0A8I6AQJ2_RAT Crumbs cell polarity complex component 1 OS=Rattus norvegicus OX=10116 GN=Crb1 PE=4 SV=1
4	D3ZZL8	0.0	2179	1407	0.749	0.748	D3ZZL8_RAT Crumbs cell polarity complex component 1 OS=Rattus norvegicus OX=10116 GN=Crb1 PE=4 SV=2
5	P10040	0.0	617	2146	0.309	0.202	CRB_DROME Protein crumbs OS=Drosophila melanogaster OX=7227 GN=crb PE=1 SV=3
6	P82279	0.0	2880	1406	1.000	1.000	CRUM1_HUMAN Protein crumbs homolog 1 OS=Homo sapiens OX=9606 GN=CRB1 PE=1 SV=2
7	Q1A5L1	0.0	917	1458	0.377	0.364	Q1A5L1_DANRE Crumbs cell polarity complex component 2b precursor OS=Danio rerio OX=7955 GN=crb2l PE=2 SV=1
8	Q1A5L2	0.0	949	1466	0.379	0.364	Q1A5L2_DANRE Crb2 OS=Danio rerio OX=7955 GN=crb2 PE=1 SV=1
9	Q1A5L3	0.0	1175	1428	0.447	0.440	Q1A5L3_DANRE Crumbs-like protein 1 OS=Danio rerio OX=7955 GN=si:dkey-114d20.6 PE=2 SV=1
10	Q5IJ48	0.0	720	1285	0.317	0.347	CRUM2_HUMAN Protein crumbs homolog 2 OS=Homo sapiens OX=9606 GN=CRB2 PE=1 SV=2
11	Q80YA8	0.0	681	1282	0.307	0.337	CRUM2_MOUSE Protein crumbs homolog 2 OS=Mus musculus OX=10090 GN=Crb2 PE=1 SV=3
12	Q8VHS2	0.0	2195	1405	0.762	0.762	CRUM1_MOUSE Protein crumbs homolog 1 OS=Mus musculus OX=10090 GN=Crb1 PE=1 SV=3
13	Q19350	1.08e-98	352	1722	0.260	0.213	Q19350_CAEEL Drosophila CRumBs homolog OS=Caenorhabditis elegans OX=6239 GN=crb-1 PE=4 SV=1
14	B8JI71	1.30e-90	328	2904	0.265	0.128	EYS_DANRE Protein eyes shut homolog OS=Danio rerio OX=7955 GN=eys PE=1 SV=2
15	A2RUV0	4.68e-87	317	2522	0.136	0.076	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
16	P21783	2.26e-86	315	2524	0.134	0.074	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
17	P07207	1.32e-83	306	2703	0.129	0.067	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
18	A0PGH6	2.60e-83	305	2465	0.126	0.072	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1
19	F1RCH4	9.33e-83	303	2475	0.137	0.078	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
20	Q01705	4.67e-82	301	2531	0.124	0.069	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	7.1	17.9	Complement Clr-like EGF-like
2	PF00008 EGF	1.8e-92	314.4	EGF-like domain
3	PF07974 EGF_2	0.14	23.9	EGF-like domain
4	PF12947 EGF_3	0.00075	30.9	EGF domain
5	PF07645 EGF_CA	6e-06	37.7	Calcium-binding EGF domain
6	PF12661 hEGF	1.4e-47	170.0	Human growth factor-like EGF
7	PF00054 Laminin_G_1	4.7e-27	106.2	Laminin G domain
8	PF02210 Laminin_G_2	8.5e-49	176.7	Laminin G domain
9	PF13385 Laminin_G_3	0.36	22.4	Concanavalin A-like lectin/glucanases superfamily
10	PF12913 SH3_6	72	14.3	SH3 domain (SH3b1 type)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356370

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261681	0.997	MAGUK p55 subfamily member 5
2	9606.ENSP00000360200	0.879	InaD-like protein
3	9606.ENSP00000370521	0.847	Aryl-hydrocarbon-interacting protein-like 1
4	9606.ENSP00000254854	0.827	Retinal guanylyl cyclase 1
5	9606.ENSP00000362734	0.823	Protein crumbs homolog 2
6	9606.ENSP00000229771	0.816	Tubby-related protein 1
7	9606.ENSP00000439807	0.812	Multiple PDZ domain protein
8	9606.ENSP00000262340	0.811	Retinoid isomerohydrolase
9	9606.ENSP00000263713	0.805	Band 4.1-like protein 5
10	9606.ENSP00000449079	0.805	Retinol dehydrogenase 12
11	9606.ENSP00000264663	0.762	NAD(P) transhydrogenase, mitochondrial
12	9606.ENSP00000349204	0.762	Protein crumbs homolog 3
13	9606.ENSP00000376686	0.757	Lebercilin
14	9606.ENSP00000221996	0.754	Cone-rod homeobox protein
15	9606.ENSP00000377176	0.752	Spermatogenesis-associated protein 7
16	9606.ENSP00000345206	0.744	Recombining binding protein suppressor of hairless
17	9606.ENSP00000359245	0.720	Retinal-specific ATP-binding cassette transporter
18	9606.ENSP00000448012	0.720	Centrosomal protein of 290 kDa
19	9606.ENSP00000337224	0.717	Lecithin retinol acyltransferase
20	9606.ENSP00000355969	0.703	Plays a critical role in the regulation of enzymes involved in nucleotide cycle in photoreceptors (PubMed:29515371, PubMed:21928830, PubMed:21078983, PubMed:27471269, PubMed:30559291). Inhibits the basal catalytic activity and the GCAP-stimulated activity of GUCY2D and GUCY2F, two retinal guanylyl cyclases involved in the production of cGMP in photoreceptors (PubMed:21928830, PubMed:27471269, PubMed:29515371, PubMed:30559291). Involved in the transport of GUCY2D and GUCY2F to their target sites in the photoreceptor outer segment . Up-regulates the activity of GUK1, a kinase that plays [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.883	biological regulation
GO:0032501	0.880	multicellular organismal process
GO:0050789	0.822	regulation of biological process
GO:0007154	0.752	cell communication
GO:0050794	0.667	regulation of cellular process
GO:0023052	0.664	signaling
GO:0032502	0.614	developmental process
GO:0007163	0.582	establishment or maintenance of cell polarity
GO:0048856	0.542	anatomical structure development
GO:0050896	0.534	response to stimulus
GO:0048731	0.415	system development
GO:0048513	0.378	animal organ development
GO:0071840	0.336	cellular component organization or biogenesis
GO:0016043	0.303	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0032991	0.988	protein-containing complex
GO:0071944	0.943	cell periphery
GO:0005886	0.929	plasma membrane
GO:0043227	0.848	membrane-bounded organelle
GO:0042995	0.771	cell projection
GO:0030054	0.763	cell junction
GO:0005622	0.752	intracellular anatomical structure
GO:0120025	0.751	plasma membrane bounded cell projection
GO:0098858	0.585	actin-based cell projection
GO:0043231	0.582	intracellular membrane-bounded organelle
GO:0070161	0.579	anchoring junction
GO:0005911	0.571	cell-cell junction
GO:0005912	0.477	adherens junction
GO:0005737	0.367	cytoplasm
GO:0001917	0.357	photoreceptor inner segment
GO:0005902	0.314	microvillus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]