StarFunc result for job id P82909

User Input

>input (103 residues)
MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSK
SPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P82908	0.409	0.409	2.144E-14	103	0.932	0.932	P82908.pdb.gz	KGD4_BOVIN Alpha-ketoglutarate dehydrogenase component 4 OS=Bos taurus OX=9913 GN=MRPS36 PE=1 SV=2
2	AFDB:Q9CQX8	0.402	0.406	1.224E-12	102	0.835	0.843	Q9CQX8.pdb.gz	KGD4_MOUSE Alpha-ketoglutarate dehydrogenase component 4 OS=Mus musculus OX=10090 GN=Mrps36 PE=1 SV=1
3	AFDB:Q9W0P2	0.128	0.028	3.474	995	0.155	0.016	Q9W0P2.pdb.gz	REV1_DROME DNA repair protein Rev1 OS=Drosophila melanogaster OX=7227 GN=Rev1 PE=1 SV=1
4	AFDB:Q02457	0.174	0.035	4.315	562	0.233	0.043	Q02457.pdb.gz	TBF1_YEAST Protein TBF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TBF1 PE=1 SV=2
5	AFDB:Q06615	0.168	0.084	4.315	236	0.155	0.068	Q06615.pdb.gz	NOTO_XENLA Homeobox protein notochord OS=Xenopus laevis OX=8355 GN=noto PE=2 SV=1
6	PDB:7odrl	0.173	0.199	4.982	82	0.126	0.159	7odrl.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
7	AFDB:Q8GZR2	0.163	0.048	5.760	496	0.175	0.036	Q8GZR2.pdb.gz	CYF_EUGGR Cytochrome f, chloroplastic OS=Euglena gracilis OX=3039 GN=petA PE=1 SV=2
8	AFDB:Q9VDP8	0.128	0.060	6.191	357	0.194	0.056	Q9VDP8.pdb.gz	Q9VDP8_DROME CG4973 protein OS=Drosophila melanogaster OX=7227 GN=mdlc PE=1 SV=1
9	PDB:3jb9M	0.145	0.087	6.651	207	0.126	0.063	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
10	AFDB:P10158	0.147	0.084	6.655	275	0.155	0.058	P10158.pdb.gz	FOSL1_RAT Fos-related antigen 1 OS=Rattus norvegicus OX=10116 GN=Fosl1 PE=2 SV=1
11	PDB:5u6yA	0.141	0.046	7.684	459	0.078	0.017	5u6yA.pdb.gz
12	AFDB:Q12329	0.182	0.056	8.884	375	0.136	0.037	Q12329.pdb.gz	HSP42_YEAST Heat shock protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSP42 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P82909	1.26e-71	209	103	1.000	1.000	KGD4_HUMAN Alpha-ketoglutarate dehydrogenase component 4 OS=Homo sapiens OX=9606 GN=MRPS36 PE=1 SV=2
2	P82908	4.76e-67	198	103	0.932	0.932	KGD4_BOVIN Alpha-ketoglutarate dehydrogenase component 4 OS=Bos taurus OX=9913 GN=MRPS36 PE=1 SV=2
3	Q9CQX8	4.23e-58	176	102	0.835	0.843	KGD4_MOUSE Alpha-ketoglutarate dehydrogenase component 4 OS=Mus musculus OX=10090 GN=Mrps36 PE=1 SV=1
4	Q9D6T9	9.16e-57	172	100	0.835	0.860	Q9D6T9_MOUSE Mitochondrial ribosomal protein S36 OS=Mus musculus OX=10090 GN=Mrps36 PE=1 SV=1
5	Q01167	1.3	30.0	660	0.175	0.027	FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens OX=9606 GN=FOXK2 PE=1 SV=3
6	Q3UCQ1	1.4	30.0	651	0.175	0.028	FOXK2_MOUSE Forkhead box protein K2 OS=Mus musculus OX=10090 GN=Foxk2 PE=1 SV=3
7	Q7ZU44	2.1	29.6	1208	0.136	0.012	Q7ZU44_DANRE High density lipoprotein-binding protein (Vigilin) OS=Danio rerio OX=7955 GN=hdlbp PE=1 SV=1
8	A2AWP0	5.6	28.1	285	0.223	0.081	BIRC7_MOUSE Baculoviral IAP repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Birc7 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10937 S36_mt	0.086	25.8	Ribosomal protein S36, mitochondrial

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256441

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000449884	0.998	Mitochondrial ribosomal protein L42
2	9606.ENSP00000053468	0.962	Mitochondrial ribosomal protein S10
3	9606.ENSP00000361206	0.960	Mitochondrial ribosomal protein S18A
4	9606.ENSP00000426941	0.957	28S ribosomal protein S27, mitochondrial
5	9606.ENSP00000272418	0.956	Belongs to the universal ribosomal protein uS5 family.
6	9606.ENSP00000259873	0.950	Mitochondrial ribosomal protein S18B
7	9606.ENSP00000360850	0.945	Mitochondrial ribosomal protein S2
8	9606.ENSP00000254630	0.939	Pentatricopeptide repeat domain-containing protein 3, mitochondrial
9	9606.ENSP00000295491	0.935	Mitochondrial ribosomal protein S18C
10	9606.ENSP00000461930	0.933	Mitochondrial ribosomal protein S21
11	9606.ENSP00000418008	0.931	Mitochondrial ribosomal protein S22
12	9606.ENSP00000357320	0.927	28S ribosomal protein S29, mitochondrial
13	9606.ENSP00000245539	0.921	Mitochondrial ribosomal protein S7
14	9606.ENSP00000258455	0.921	Mitochondrial ribosomal protein S9
15	9606.ENSP00000420714	0.920	Mitochondrial ribosomal protein S14
16	9606.ENSP00000317376	0.915	Mitochondrial ribosomal protein S11
17	9606.ENSP00000362208	0.915	Mitochondrial ribosomal protein S15
18	9606.ENSP00000384952	0.914	Mitochondrial ribosomal protein S12
19	9606.ENSP00000362036	0.912	Mitochondrial ribosomal protein S16
20	9606.ENSP00000382250	0.908	Mitochondrial ribosomal protein S6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.885	nucleic acid binding
GO:0000981	0.572	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003723	0.337	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0044281	0.984	small molecule metabolic process
GO:0043648	0.858	dicarboxylic acid metabolic process
GO:0009060	0.857	aerobic respiration
GO:0006099	0.534	tricarboxylic acid cycle
GO:0006103	0.462	2-oxoglutarate metabolic process
GO:0006807	0.302	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.999	mitochondrial inner membrane
GO:0070013	0.917	intracellular organelle lumen
GO:0005759	0.914	mitochondrial matrix
GO:0032991	0.890	protein-containing complex
GO:0098798	0.781	mitochondrial protein-containing complex
GO:0043232	0.571	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]