StarFunc result for job id P82970

User Input

>input (282 residues)
MPKRKAAGQGDMRQEPKRRSARLSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSA
QAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVA
AEVKNEEEDQKEDEEDQNEEKGEAGKEDKDEKGEEDGKEDKNGNEKGEDAKEKEDGKKGE
DGKGNGEDGKEKGEDEKEEEDRKETGDGKENEDGKEKGDKKEGKDVKVKEDEKEREDGKE
DEGGNEEEAGKEKEDLKEEEEGKEEDEIKEDDGKKEEPQSIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P82970	0.999	0.999	6.703E-31	282	1.000	1.000	P82970.pdb.gz	HMGN5_HUMAN High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
2	AFDB:Q9JL35	0.139	0.102	1.458E-7	406	0.489	0.340	Q9JL35.pdb.gz	HMGN5_MOUSE High mobility group nucleosome-binding domain-containing protein 5 OS=Mus musculus OX=10090 GN=Hmgn5 PE=1 SV=2
3	AFDB:A4L7N3	0.138	0.069	5.164	662	0.106	0.045	A4L7N3.pdb.gz	FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=2 SV=1
4	AFDB:O14319	0.105	0.060	8.766	569	0.262	0.130	O14319.pdb.gz	CUE5_SCHPO CUE domain-containing protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16E9.02c PE=4 SV=1
5	AFDB:Q9LR70	0.084	0.033	9.454	801	0.160	0.056	Q9LR70.pdb.gz	Q9LR70_ARATH H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Arabidopsis thaliana OX=3702 GN=NAF1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P82970	0.0	504	282	1.000	1.000	HMGN5_HUMAN High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
2	Q5JSK9	2.51e-123	352	201	0.706	0.990	Q5JSK9_HUMAN High mobility group nucleosome binding domain 5 (Fragment) OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
3	Q5JSK6	4.36e-102	296	161	0.571	1.000	Q5JSK6_HUMAN High mobility group nucleosome binding domain 5 (Fragment) OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
4	Q5JSL0	1.95e-98	286	148	0.525	1.000	Q5JSL0_HUMAN High mobility group nucleosome binding domain 5 (Fragment) OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
5	Q9JL35	6.72e-40	145	406	0.355	0.246	HMGN5_MOUSE High mobility group nucleosome-binding domain-containing protein 5 OS=Mus musculus OX=10090 GN=Hmgn5 PE=1 SV=2
6	Q9DCB1	2.35e-06	47.4	99	0.142	0.404	HMGN3_MOUSE High mobility group nucleosome-binding domain-containing protein 3 OS=Mus musculus OX=10090 GN=Hmgn3 PE=1 SV=1
7	P18608	4.17e-05	43.9	96	0.074	0.219	HMGN1_MOUSE Non-histone chromosomal protein HMG-14 OS=Mus musculus OX=10090 GN=Hmgn1 PE=1 SV=2
8	P02315	0.039	34.7	70	0.064	0.257	H6_ONCMY Non-histone chromosomal protein H6 OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
9	P05114	0.050	35.0	100	0.060	0.170	HMGN1_HUMAN Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3
10	C1BFL7	0.11	33.1	66	0.060	0.258	C1BFL7_ONCMY Nonhistone chromosomal protein H6 OS=Oncorhynchus mykiss OX=8022 GN=H6 PE=2 SV=1
11	Q8I3A0	0.13	36.2	2568	0.117	0.013	Q8I3A0_PLAF7 Copper-transporting ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0904900 PE=4 SV=2
12	Q8IBZ6	0.54	34.3	2729	0.071	0.007	Q8IBZ6_PLAF7 Mediator of RNA polymerase II transcription subunit 14 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0709300 PE=3 SV=1
13	Q15651	0.67	32.0	99	0.060	0.172	HMGN3_HUMAN High mobility group nucleosome-binding domain-containing protein 3 OS=Homo sapiens OX=9606 GN=HMGN3 PE=1 SV=2
14	A0A087WZE9	0.92	32.0	130	0.060	0.131	A0A087WZE9_HUMAN High mobility group nucleosomal binding domain 3 OS=Homo sapiens OX=9606 GN=HMGN3 PE=1 SV=1
15	P09602	1.4	30.8	90	0.064	0.200	HMGN2_MOUSE Non-histone chromosomal protein HMG-17 OS=Mus musculus OX=10090 GN=Hmgn2 PE=1 SV=2
16	P05204	1.5	30.8	90	0.064	0.200	HMGN2_HUMAN Non-histone chromosomal protein HMG-17 OS=Homo sapiens OX=9606 GN=HMGN2 PE=1 SV=3
17	O00479	1.6	30.4	90	0.064	0.200	HMGN4_HUMAN High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3
18	P02313	1.6	30.8	90	0.064	0.200	HMGN2_BOVIN Non-histone chromosomal protein HMG-17 OS=Bos taurus OX=9913 GN=HMGN2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01101 HMG14_17	7.4e-23	92.7	HMG14 and HMG17

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350848

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355228	0.907	Non-histone chromosomal protein HMG-17
2	9606.ENSP00000370125	0.901	Non-histone chromosomal protein HMG-14
3	9606.ENSP00000344504	0.839	Histone H1.0
4	9606.ENSP00000354206	0.734	Zinc finger protein 219
5	9606.ENSP00000227918	0.676	Mammaglobin-A
6	9606.ENSP00000406261	0.629	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
7	9606.ENSP00000376097	0.619	Unconventional prefoldin RPB5 interactor 1
8	9606.ENSP00000410083	0.609	Vezatin
9	9606.ENSP00000365433	0.605	Transcription factor 19
10	9606.ENSP00000219789	0.592	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
11	9606.ENSP00000482613	0.574	High mobility group nucleosomal binding domain 3
12	9606.ENSP00000360464	0.549	NF-kappa-B-activating protein
13	9606.ENSP00000366798	0.502	High mobility group nucleosomal binding domain 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.853	protein binding
GO:0003677	0.534	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0048518	0.980	positive regulation of biological process
GO:0048519	0.971	negative regulation of biological process
GO:0010468	0.967	regulation of gene expression
GO:0048522	0.966	positive regulation of cellular process
GO:0010941	0.958	regulation of cell death
GO:0043067	0.935	regulation of programmed cell death
GO:0042127	0.929	regulation of cell population proliferation
GO:0048523	0.885	negative regulation of cellular process
GO:0042981	0.874	regulation of apoptotic process
GO:0009987	0.738	cellular process
GO:0009893	0.508	positive regulation of metabolic process
GO:0043066	0.508	negative regulation of apoptotic process
GO:0010628	0.494	positive regulation of gene expression
GO:0008284	0.491	positive regulation of cell population proliferation
GO:0008152	0.316	metabolic process
GO:0071704	0.307	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.998	cytoplasm
GO:0005739	0.881	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]