StarFunc result for job id P82979

User Input

>input (210 residues)
MATETVELHKLKLAELKQECLARGLETKGIKQDLIHRLQAYLEEHAEEEANEEDVLGDET
EEEETKPIELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKK
AARAARFGISSVPTKGLSSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKER
FGIVTSSAGTGTTEDTEAKKRKRAERFGIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8VZQ9	0.394	0.389	5.937E-26	213	0.957	0.944	F8VZQ9.pdb.gz	F8VZQ9_HUMAN SAP domain containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=1
2	AFDB:Q28HK0	0.380	0.385	4.638E-21	207	0.743	0.754	Q28HK0.pdb.gz	Q28HK0_XENTR Novel proteinn (Ortholog of human cytokine induced protein 29 kDa CIP29) OS=Xenopus tropicalis OX=8364 GN=sarnp PE=2 SV=1
3	AFDB:Q9VHC8	0.220	0.169	4.789E-6	308	0.343	0.234	Q9VHC8.pdb.gz	Q9VHC8_DROME LD31448p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8149 PE=1 SV=1
4	AFDB:O74871	0.224	0.194	5.185E-5	245	0.300	0.257	O74871.pdb.gz	YCW3_SCHPO Uncharacterized protein C31H12.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC31H12.03c PE=1 SV=1
5	AFDB:C0H535	0.238	0.175	1.549E-4	288	0.252	0.184	C0H535.pdb.gz	C0H535_PLAF7 SAP domain-containing protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0912500 PE=4 SV=1
6	AFDB:Q9BTB7	0.167	0.282	3.405E-3	122	0.157	0.270	Q9BTB7.pdb.gz	Q9BTB7_HUMAN Heterogeneous nuclear ribonucleoprotein U-like 1 OS=Homo sapiens OX=9606 GN=HNRPUL1 PE=1 SV=1
7	AFDB:Q03673	0.189	0.200	1.316E-2	198	0.114	0.121	Q03673.pdb.gz	AIM34_YEAST Altered inheritance of mitochondria protein 34, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIM34 PE=1 SV=1
8	AFDB:P40040	0.195	0.189	1.702E-2	218	0.214	0.206	P40040.pdb.gz	THO1_YEAST Protein THO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=THO1 PE=1 SV=1
9	AFDB:E1JGL8	0.180	0.030	2.065E-2	1272	0.114	0.019	E1JGL8.pdb.gz	E1JGL8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG30122 PE=1 SV=1
10	AFDB:Q8CCG4	0.173	0.124	3.241E-2	296	0.162	0.115	Q8CCG4.pdb.gz	DPPA4_MOUSE Developmental pluripotency-associated protein 4 OS=Mus musculus OX=10090 GN=Dppa4 PE=1 SV=2
11	PDB:1zbuB	0.188	0.130	3.687E-1	304	0.052	0.036	1zbuB.pdb.gz	Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
12	PDB:1kcfA	0.109	0.096	2.236	240	0.043	0.037	1kcfA.pdb.gz
13	PDB:7pntZ	0.109	0.201	3.290	101	0.081	0.168	7pntZ.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
14	PDB:3jd5i	0.099	0.184	3.743	98	0.090	0.194	3jd5i.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
15	PDB:6elzJ	0.134	0.176	3.991	145	0.095	0.138	6elzJ.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
16	PDB:6id0L	0.115	0.057	5.164	475	0.167	0.074	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
17	PDB:7p2eZ	0.111	0.202	5.507	100	0.071	0.150	7p2eZ.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
18	PDB:5yzgL	0.114	0.068	6.264	419	0.167	0.084	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:2ze5A	0.112	0.105	7.125	227	0.033	0.031	2ze5A.pdb.gz	Structural insight into the reaction mechanism and evolution of cytokinin biosynthesis.
20	PDB:5gm6c	0.132	0.077	7.125	415	0.119	0.060	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P82979	6.27e-150	416	210	1.000	1.000	SARNP_HUMAN SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3
2	Q9D1J3	9.82e-143	398	210	0.957	0.957	SARNP_MOUSE SAP domain-containing ribonucleoprotein OS=Mus musculus OX=10090 GN=Sarnp PE=1 SV=3
3	F8VZQ9	2.09e-140	392	213	0.943	0.930	F8VZQ9_HUMAN SAP domain containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=1
4	H0YHG0	2.40e-136	394	523	0.948	0.380	H0YHG0_HUMAN DnaJ homolog subfamily C member 14 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
5	Q28HK0	1.39e-86	256	207	0.733	0.744	Q28HK0_XENTR Novel proteinn (Ortholog of human cytokine induced protein 29 kDa CIP29) OS=Xenopus tropicalis OX=8364 GN=sarnp PE=2 SV=1
6	O74871	4.23e-11	62.4	245	0.338	0.290	YCW3_SCHPO Uncharacterized protein C31H12.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC31H12.03c PE=1 SV=1
7	Q9VHC8	3.07e-05	45.8	308	0.267	0.182	Q9VHC8_DROME LD31448p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8149 PE=1 SV=1
8	C0H535	5.58e-05	45.1	288	0.195	0.142	C0H535_PLAF7 SAP domain-containing protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0912500 PE=4 SV=1
9	Q9LZ08	6.24e-05	44.7	214	0.219	0.215	MOS11_ARATH Protein MODIFIER OF SNC1 11 OS=Arabidopsis thaliana OX=3702 GN=MOS11 PE=1 SV=1
10	A8E6M1	2.03e-04	43.9	1271	0.095	0.016	A8E6M1_DROME GH01011p OS=Drosophila melanogaster OX=7227 GN=CG5477 PE=1 SV=1
11	E1JGL8	2.03e-04	43.9	1272	0.095	0.016	E1JGL8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG30122 PE=1 SV=1
12	A1ZBB4	2.04e-04	43.9	1271	0.095	0.016	A1ZBB4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=hnRNP U PE=1 SV=1
13	Q6IMY8	0.001	41.6	798	0.105	0.028	HNRPU_RAT Heterogeneous nuclear ribonucleoprotein U OS=Rattus norvegicus OX=10116 GN=Hnrnpu PE=1 SV=1
14	Q8VEK3	0.001	41.6	800	0.105	0.028	HNRPU_MOUSE Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus OX=10090 GN=Hnrnpu PE=1 SV=1
15	Q9BUJ2	0.001	41.6	856	0.110	0.027	HNRL1_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2
16	Q9BTB7	0.003	38.5	122	0.110	0.189	Q9BTB7_HUMAN Heterogeneous nuclear ribonucleoprotein U-like 1 OS=Homo sapiens OX=9606 GN=HNRPUL1 PE=1 SV=1
17	A0A0S4XR43	0.009	38.9	1215	0.100	0.017	A0A0S4XR43_CAEEL SAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccar-1 PE=1 SV=1
18	A0A1X7SBS1	0.011	38.5	744	0.095	0.027	A0A1X7SBS1_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
19	Q00839	0.011	38.9	825	0.095	0.024	HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6
20	Q9ULH7	0.017	38.1	1088	0.090	0.017	MRTFB_HUMAN Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07766 LETM1_RBD	1.4e+02	13.4	LETM1-like, RBD
2	PF02037 SAP	1.1e-06	39.5	SAP domain
3	PF18953 SAP_new25	0.41	21.6	SAP domain-containing new25
4	PF18592 Tho1_MOS11_C	8.9e-07	40.1	Tho1/MOS11 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_010348238.1

Rank	PPI partner	STRING score	Description
1	27679.XP_010350775.1	0.992	ATP-dependent RNA helicase DDX39A isoform X3
2	27679.XP_003924839.1	0.991	THO complex subunit 1
3	27679.XP_010328089.1	0.990	Spliceosome RNA helicase DDX39B-like
4	27679.XP_010330591.1	0.990	LOW QUALITY PROTEIN: spliceosome RNA helicase DDX39B
5	27679.XP_010340808.1	0.986	THO complex subunit 4
6	27679.XP_010338334.1	0.984	LOW QUALITY PROTEIN: coiled-coil domain-containing protein 144A
7	27679.XP_003932849.1	0.982	Polymerase delta-interacting protein 3
8	27679.XP_010340012.1	0.980	THO complex subunit 2 isoform X1
9	27679.XP_010347474.1	0.977	LOW QUALITY PROTEIN: THO complex subunit 5 homolog
10	27679.XP_003934406.1	0.976	Zinc finger CCCH domain-containing protein 13 isoform X1
11	27679.XP_010327941.1	0.972	Chromatin target of PRMT1 protein isoform X1
12	27679.XP_003940268.2	0.963	THO complex subunit 7 homolog
13	27679.XP_003928491.1	0.956	THO complex subunit 6 homolog
14	27679.XP_003936175.1	0.945	THO complex subunit 3
15	27679.XP_003925470.1	0.864	LOW QUALITY PROTEIN: ATP-dependent RNA helicase A
16	27679.XP_010339723.1	0.848	UAP56-interacting factor isoform X1
17	27679.XP_003944746.1	0.838	Necessary for the splicing of pre-mRNA.
18	27679.XP_003934774.1	0.824	Ras-related protein Rab-28
19	27679.XP_010343920.1	0.824	pre-mRNA cleavage complex 2 protein Pcf11 isoform X1
20	27679.XP_010350226.1	0.824	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 2 codons

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003676	0.998	nucleic acid binding
GO:0005515	0.996	protein binding
GO:0003682	0.994	chromatin binding
GO:0003723	0.892	RNA binding
GO:0140375	0.883	immune receptor activity
GO:0004888	0.827	transmembrane signaling receptor activity
GO:0001792	0.557	polymeric immunoglobulin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0009987	0.989	cellular process
GO:0010467	0.987	gene expression
GO:0051179	0.985	localization
GO:0006403	0.983	RNA localization
GO:0050794	0.975	regulation of cellular process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0046907	0.973	intracellular transport
GO:0051168	0.961	nuclear export
GO:0050658	0.961	RNA transport
GO:0080090	0.959	regulation of primary metabolic process
GO:0051171	0.959	regulation of nitrogen compound metabolic process
GO:0031323	0.959	regulation of cellular metabolic process
GO:0010468	0.948	regulation of gene expression
GO:0051252	0.948	regulation of RNA metabolic process
GO:0006405	0.943	RNA export from nucleus
GO:0031326	0.930	regulation of cellular biosynthetic process
GO:0010556	0.929	regulation of macromolecule biosynthetic process
GO:0051028	0.923	mRNA transport
GO:0048519	0.848	negative regulation of biological process
GO:0006406	0.814	mRNA export from nucleus
GO:0048523	0.808	negative regulation of cellular process
GO:0009892	0.795	negative regulation of metabolic process
GO:0006355	0.790	regulation of DNA-templated transcription
GO:0051172	0.718	negative regulation of nitrogen compound metabolic process
GO:0010605	0.713	negative regulation of macromolecule metabolic process
GO:0031324	0.642	negative regulation of cellular metabolic process
GO:0045934	0.625	negative regulation of nucleobase-containing compound metabolic process
GO:0044238	0.612	primary metabolic process
GO:0006357	0.566	regulation of transcription by RNA polymerase II
GO:0051253	0.479	negative regulation of RNA metabolic process
GO:0006807	0.331	nitrogen compound metabolic process
GO:0044237	0.303	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0016607	0.970	nuclear speck
GO:0140513	0.946	nuclear protein-containing complex
GO:0099080	0.883	supramolecular complex
GO:0035770	0.872	ribonucleoprotein granule
GO:0036464	0.736	cytoplasmic ribonucleoprotein granule
GO:0005829	0.311	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]