StarFunc result for job id P82987

User Input

>input (1691 residues)
MASWTSPWWVLIGMVFMHSPLPQTTAEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRY
DDQTSRNTRSDEDKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSN
HDCPPDAEDFRAQQCSAYNDVQYQGHYYEWLPRYNDPAAPCALKCHAQGQNLVVELAPKV
LDGTRCNTDSLDMCISGICQAVGCDRQLGSNAKEDNCGVCAGDGSTCRLVRGQSKSHVSP
EKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSPGVFLVENTTVEFQR
GSERQTFKIPGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQ
LNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLP
RWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP
KWIAMEWSQCTVTCGRGLRYRVVLCINHRGEHVGGCNPQLKLHIKEECVIPIPCYKPKEK
SPVEAKLPWLKQAQELEETRIATEEPTFIPEPWSACSTTCGPGVQVREVKCRVLLTFTQT
ETELPEEECEGPKLPTERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATC
VGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSATCG
VGIQTRDVYCLHPGETPAPPEECRDEKPHALQACNQFDCPPGWHIEEWQQCSRTCGGGTQ
NRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCGVGIQ
RRKQVCQRLAAKGRRIPLSEMMCRDLPGLPLVRSCQMPECSKIKSEMKTKLGEQGPQILS
VQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQNSKRLG
ITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLKLIGTDNRLIARPALREPMREYPGMDH
SEANSLGVTWHKMRQMWNNKNDLYLDDDHISNQPFLRALLGHCSNSAGSTNSWELKNKQF
EAAVKQGAYSMDTAQFDELIRNMSQLMETGEVSDDLASQLIYQLVAELAKAQPTHMQWRG
IQEETPPAAQLRGETGSVSQSSHAKNSGKLTFKPKGPVLMRQSQPPSISFNKTINSRIGN
TVYITKRTEVINILCDLITPSEATYTWTKDGTLLQPSVKIILDGTGKIQIQNPTRKEQGI
YECSVANHLGSDVESSSVLYAEAPVILSVERNITKPEHNHLSVVVGGIVEAALGANVTIR
CPVKGVPQPNITWLKRGGSLSGNVSLLFNGSLLLQNVSLENEGTYVCIATNALGKAVATS
VLHLLERRWPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQEPFWEPGNWSHCSATC
GHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVSCG
EGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPGNRCPGRCMGR
AVRMQQRHTACQHNSSDSNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGRGFQSR
KVDCIHTRSCKPVAKRHCVQKKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRY
KQRCCQSCQEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P82987	1.000	1.000	0.000	1691	1.000	1.000	P82987.pdb.gz	ATL3_HUMAN ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=ADAMTSL3 PE=1 SV=4
2	AFDB:Q8BLI0	0.219	0.213	0.000	1745	0.431	0.418	Q8BLI0.pdb.gz	ATL1_MOUSE ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=Adamtsl1 PE=2 SV=2
3	AFDB:Q8N6G6	0.174	0.167	0.000	1762	0.439	0.422	Q8N6G6.pdb.gz	ATL1_HUMAN ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=ADAMTSL1 PE=1 SV=4
4	AFDB:Q19791	0.135	0.108	7.823E-68	2150	0.189	0.148	Q19791.pdb.gz	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
5	AFDB:P90884	0.082	0.122	1.830E-66	1045	0.182	0.295	P90884.pdb.gz	MADD4_CAEEL Protein madd-4 OS=Caenorhabditis elegans OX=6239 GN=madd-4 PE=1 SV=5
6	AFDB:Q9P2N4	0.148	0.131	1.647E-65	1935	0.183	0.160	Q9P2N4.pdb.gz	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
7	AFDB:P59511	0.148	0.133	4.003E-63	1906	0.186	0.165	P59511.pdb.gz	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
8	AFDB:Q9EPX2	0.137	0.175	1.454E-62	1280	0.173	0.229	Q9EPX2.pdb.gz	PPN_MOUSE Papilin OS=Mus musculus OX=10090 GN=Papln PE=2 SV=2
9	AFDB:E9PUN6	0.148	0.131	1.661E-61	1931	0.182	0.159	E9PUN6.pdb.gz	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
10	AFDB:D4A0T9	0.142	0.165	1.220E-49	1425	0.134	0.159	D4A0T9.pdb.gz	D4A0T9_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 13 OS=Rattus norvegicus OX=10116 GN=Adamts13 PE=4 SV=3
11	PDB:5oj2B	0.085	0.179	3.336E-11	692	0.060	0.147	5oj2B.pdb.gz
12	PDB:1w0rA	0.049	0.128	1.211E-10	442	0.054	0.206	1w0rA.pdb.gz
13	PDB:6dldD	0.083	0.379	1.598E-9	269	0.028	0.175	6dldD.pdb.gz
14	PDB:6dlfA	0.081	0.428	5.532E-9	236	0.022	0.161	6dlfA.pdb.gz
15	PDB:1e07A	0.067	0.146	1.358E-7	642	0.055	0.145	1e07A.pdb.gz
16	PDB:6feyB	0.054	0.408	8.746E-7	207	0.027	0.217	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
17	PDB:6feyD	0.051	0.504	3.331E-6	160	0.022	0.237	6feyD.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
18	PDB:3o3uN	0.072	0.176	6.502E-6	580	0.019	0.055	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
19	PDB:4lnvA	0.060	0.069	2.146E-5	1276	0.047	0.062	4lnvA.pdb.gz
20	PDB:5a42A	0.059	0.061	6.138E-5	1597	0.071	0.075	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P82987	0.0	3517	1691	1.000	1.000	ATL3_HUMAN ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=ADAMTSL3 PE=1 SV=4
2	Q8BLI0	0.0	1241	1745	0.407	0.394	ATL1_MOUSE ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=Adamtsl1 PE=2 SV=2
3	Q8N6G6	0.0	1304	1762	0.421	0.404	ATL1_HUMAN ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=ADAMTSL1 PE=1 SV=4
4	Q19791	7.97e-77	286	2150	0.153	0.120	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
5	P59511	4.22e-76	283	1906	0.152	0.135	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
6	Q4VC17	5.16e-76	280	1219	0.127	0.176	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
7	H2L2A7	7.98e-75	279	2165	0.153	0.119	H2L2A7_CAEEL Peptidase M12B domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=1
8	Q9EPX2	4.71e-73	271	1280	0.109	0.144	PPN_MOUSE Papilin OS=Mus musculus OX=10090 GN=Papln PE=2 SV=2
9	O76840	1.15e-72	272	2167	0.125	0.097	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
10	D3Z1A5	3.64e-71	263	1117	0.102	0.154	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
11	Q868Z9	1.73e-70	265	2898	0.128	0.075	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
12	Q9H324	1.81e-70	261	1103	0.102	0.157	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
13	Q9UKP5	1.95e-70	261	1117	0.102	0.155	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
14	Q8TE60	1.21e-68	256	1221	0.116	0.161	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
15	Q69Z28	2.25e-68	256	1222	0.123	0.170	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
16	D3ZLL7	3.96e-68	255	1221	0.122	0.170	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
17	P59510	1.24e-66	252	1910	0.150	0.132	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
18	Q9P2N4	2.50e-66	251	1935	0.142	0.124	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
19	E7FEJ5	1.55e-64	244	1244	0.113	0.154	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
20	F1SFS3	1.58e-64	246	2000	0.140	0.118	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19236 ADAMTS_CR_3	6.3e-06	37.6	ADAMTS cysteine-rich domain
2	PF07679 I-set	3.1e-24	96.2	Immunoglobulin I-set domain
3	PF00047 ig	3.6e-11	54.4	Immunoglobulin domain
4	PF13895 Ig_2	8.1e-15	66.2	Immunoglobulin domain
5	PF13927 Ig_3	1.4e-24	97.7	Immunoglobulin domain
6	PF16706 Izumo-Ig	3.8e+02	12.4	Izumo-like Immunoglobulin domain
7	PF08686 PLAC	9.3e-06	37.6	PLAC (protease and lacunin) domain
8	PF20155 TMP_3	2.7	19.2	Tape measure protein
9	PF19030 TSP1_ADAMTS	3.9e-103	349.0	Thrombospondin type 1 domain
10	PF19035 TSP1_CCN	4.9e-20	82.9	CCN3 Nov like TSP1 domain
11	PF19028 TSP1_spondin	2.1e-13	61.7	Spondin-like TSP1 domain
12	PF00090 TSP_1	9.6e-45	161.9	Thrombospondin type 1 domain
13	PF07686 V-set	4.5e-07	41.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286744

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339613	0.946	GDP-fucose protein O-fucosyltransferase 2
2	9606.ENSP00000284984	0.927	A disintegrin and metalloproteinase with thrombospondin motifs 1
3	9606.ENSP00000270328	0.924	A disintegrin and metalloproteinase with thrombospondin motifs 10
4	9606.ENSP00000274181	0.924	ADAM metallopeptidase with thrombospondin type 1 motif 16
5	9606.ENSP00000268070	0.923	ADAM metallopeptidase with thrombospondin type 1 motif 17
6	9606.ENSP00000373472	0.923	A disintegrin and metalloproteinase with thrombospondin motifs 7
7	9606.ENSP00000422554	0.923	A disintegrin and metalloproteinase with thrombospondin motifs 12
8	9606.ENSP00000327608	0.922	ADAMTS-like protein 5
9	9606.ENSP00000284987	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 5
10	9606.ENSP00000374071	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 20
11	9606.ENSP00000346478	0.920	ADAMTS-like protein 2
12	9606.ENSP00000358035	0.919	ADAMTS-like protein 4
13	9606.ENSP00000274487	0.917	ADAM metallopeptidase with thrombospondin type 1 motif 19
14	9606.ENSP00000355751	0.917	Thrombospondin-2
15	9606.ENSP00000247153	0.916	Properdin
16	9606.ENSP00000299164	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 15
17	9606.ENSP00000418735	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 9
18	9606.ENSP00000258613	0.914	Thrombospondin type-1 domain-containing protein 1
19	9606.ENSP00000370443	0.914	ADAM metallopeptidase with thrombospondin type 1 motif 6
20	9606.ENSP00000251582	0.913	A disintegrin and metalloproteinase with thrombospondin motifs 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.372	catalytic activity
GO:0140096	0.312	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071840	0.878	cellular component organization or biogenesis
GO:0016043	0.872	cellular component organization
GO:0065007	0.613	biological regulation
GO:0032502	0.607	developmental process
GO:0050794	0.513	regulation of cellular process
GO:0008152	0.461	metabolic process
GO:0032501	0.444	multicellular organismal process
GO:0071704	0.444	organic substance metabolic process
GO:0048856	0.345	anatomical structure development
GO:0006807	0.341	nitrogen compound metabolic process
GO:0044238	0.339	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005737	0.994	cytoplasm
GO:0012505	0.991	endomembrane system
GO:0031974	0.986	membrane-enclosed lumen
GO:0043233	0.984	organelle lumen
GO:0071944	0.964	cell periphery
GO:0070013	0.964	intracellular organelle lumen
GO:0031012	0.700	extracellular matrix
GO:0005783	0.665	endoplasmic reticulum
GO:0062023	0.434	collagen-containing extracellular matrix
GO:0005576	0.365	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]