StarFunc result for job id P83859

User Input

>input (136 residues)
MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLR
ASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELN
GYSRKKGGFSFRFGRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P83859	1.000	1.000	2.111E-21	136	1.000	1.000	P83859.pdb.gz	OX26_HUMAN Orexigenic neuropeptide QRFP OS=Homo sapiens OX=9606 GN=QRFP PE=2 SV=1
2	AFDB:P83860	0.216	0.232	3.580E-8	124	0.574	0.629	P83860.pdb.gz	OX26_RAT Orexigenic neuropeptide QRFP OS=Rattus norvegicus OX=10116 GN=Qrfp PE=1 SV=1
3	AFDB:Q84R17	0.164	0.173	9.509E-1	126	0.118	0.127	Q84R17.pdb.gz	Q84R17_ARATH At4g24275 OS=Arabidopsis thaliana OX=3702 GN=At4g24275 PE=1 SV=1
4	AFDB:F1QMB8	0.191	0.145	2.931	195	0.125	0.087	F1QMB8.pdb.gz
5	AFDB:P40187	0.122	0.047	3.883	538	0.162	0.041	P40187.pdb.gz	PIG2_YEAST GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG2 PE=1 SV=1
6	AFDB:D4AB66	0.138	0.030	6.354	895	0.176	0.027	D4AB66.pdb.gz	STON2_RAT Stonin-2 OS=Rattus norvegicus OX=10116 GN=Ston2 PE=1 SV=1
7	AFDB:Q8WXE9	0.140	0.033	6.354	905	0.176	0.027	Q8WXE9.pdb.gz	STON2_HUMAN Stonin-2 OS=Homo sapiens OX=9606 GN=STON2 PE=1 SV=1
8	AFDB:A1ZB86	0.207	0.064	6.817	609	0.103	0.023	A1ZB86.pdb.gz	KLD10_DROME Kelch domain-containing protein 10 homolog OS=Drosophila melanogaster OX=7227 GN=slim PE=1 SV=2
9	AFDB:Q86VX9	0.146	0.043	6.817	652	0.272	0.057	Q86VX9.pdb.gz	MON1A_HUMAN Vacuolar fusion protein MON1 homolog A OS=Homo sapiens OX=9606 GN=MON1A PE=1 SV=3
10	PDB:7pntS	0.114	0.114	7.174	136	0.132	0.132	7pntS.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
11	AFDB:A0A1D8PJR1	0.159	0.054	7.847	619	0.184	0.040	A0A1D8PJR1.pdb.gz	A0A1D8PJR1_CANAL Uso5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=USO5 PE=4 SV=1
12	PDB:5apnC	0.117	0.052	8.257	361	0.088	0.033	5apnC.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P83859	1.44e-95	273	136	1.000	1.000	OX26_HUMAN Orexigenic neuropeptide QRFP OS=Homo sapiens OX=9606 GN=QRFP PE=2 SV=1
2	Q8CE23	2.12e-40	133	124	0.566	0.621	OX26_MOUSE Orexigenic neuropeptide QRFP OS=Mus musculus OX=10090 GN=Qrfp PE=2 SV=1
3	P83860	5.73e-40	132	124	0.544	0.597	OX26_RAT Orexigenic neuropeptide QRFP OS=Rattus norvegicus OX=10116 GN=Qrfp PE=1 SV=1
4	F5HPR8	1.30e-13	65.5	152	0.456	0.408	F5HPR8_TAEGU 26RFa protein OS=Taeniopygia guttata OX=59729 GN=26RFa PE=2 SV=1
5	P83683	2.32e-06	43.5	26	0.147	0.769	OX26_PELLE Orexigenic neuropeptide 26RFa OS=Pelophylax lessonae OX=45623 PE=1 SV=1
6	C3Z6E6	0.021	35.4	131	0.140	0.145	QRFP_BRAFL QRFP-like peptide OS=Branchiostoma floridae OX=7739 GN=QRFP PE=1 SV=1
7	Q54VG0	1.5	30.8	900	0.110	0.017	DHTK1_DICDI Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1 homolog, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=odhA PE=3 SV=1
8	Q38BQ8	2.2	30.4	1272	0.162	0.017	Q38BQ8_TRYB2 TLDc domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4040 PE=4 SV=1
9	Q8IVF5	4.1	29.6	1701	0.125	0.010	TIAM2_HUMAN Rho guanine nucleotide exchange factor TIAM2 OS=Homo sapiens OX=9606 GN=TIAM2 PE=2 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11109 RFamide_26RFa	2.6e-62	220.4	Orexigenic neuropeptide Qrfp/P518

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485512

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377948	0.997	Pyroglutamylated RFamide peptide receptor
2	9606.ENSP00000267017	0.905	Pro-FMRFamide-related neuropeptide FF
3	9606.ENSP00000165524	0.860	Prolactin-releasing peptide
4	9606.ENSP00000307822	0.830	Neuropeptide FF receptor 2
5	9606.ENSP00000222674	0.809	Pro-FMRFamide-related neuropeptide VF
6	9606.ENSP00000239032	0.787	Prolactin-releasing peptide receptor
7	9606.ENSP00000286548	0.786	Guanine nucleotide-binding protein G(q) subunit alpha
8	9606.ENSP00000356162	0.725	Metastasis-suppressor KiSS-1
9	9606.ENSP00000276414	0.703	Progonadoliberin-1
10	9606.ENSP00000335074	0.699	Appetite-regulating hormone
11	9606.ENSP00000340526	0.686	Urotensin-2B
12	9606.ENSP00000293330	0.678	Orexin
13	9606.ENSP00000303452	0.674	Pro-thyrotropin-releasing hormone
14	9606.ENSP00000277942	0.661	Neuropeptide FF receptor 1
15	9606.ENSP00000295619	0.657	Prokineticin-2
16	9606.ENSP00000354652	0.656	Neuropeptide Y receptor type 1
17	9606.ENSP00000378089	0.629	Neuromedin-B
18	9606.ENSP00000054668	0.610	Urotensin 2
19	9606.ENSP00000361413	0.603	Fibrinogen C domain-containing protein 1
20	9606.ENSP00000381105	0.599	Neuropeptide S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005184	0.999	neuropeptide hormone activity
GO:0001664	0.697	G protein-coupled receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050896	0.989	response to stimulus
GO:0009987	0.988	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0007186	0.984	G protein-coupled receptor signaling pathway
GO:0032501	0.482	multicellular organismal process
GO:0007218	0.423	neuropeptide signaling pathway
GO:0065008	0.354	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]