StarFunc result for job id P83916

User Input

>input (185 residues)
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDC
PDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPE
RIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDK
KDDKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O93480	0.465	0.465	6.792E-29	185	0.957	0.957	O93480.pdb.gz	O93480_CHICK Chromobox protein (CHCB1) OS=Gallus gallus OX=9031 PE=2 SV=1
2	AFDB:P45973	0.394	0.382	3.050E-22	191	0.616	0.597	P45973.pdb.gz	CBX5_HUMAN Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1
3	AFDB:P23198	0.403	0.407	4.592E-22	183	0.697	0.705	P23198.pdb.gz	CBX3_MOUSE Chromobox protein homolog 3 OS=Mus musculus OX=10090 GN=Cbx3 PE=1 SV=2
4	AFDB:P05205	0.402	0.370	1.246E-16	206	0.476	0.427	P05205.pdb.gz	HP1_DROME Heterochromatin protein 1 OS=Drosophila melanogaster OX=7227 GN=Su(var)205 PE=1 SV=2
5	AFDB:Q95SE0	0.378	0.324	3.784E-16	240	0.481	0.371	Q95SE0.pdb.gz	Q95SE0_DROME GM01918p OS=Drosophila melanogaster OX=7227 GN=HP1b PE=1 SV=1
6	AFDB:Q9VCU6	0.348	0.273	4.066E-14	237	0.319	0.249	Q9VCU6.pdb.gz	Q9VCU6_DROME Heterochromatin protein 1c OS=Drosophila melanogaster OX=7227 GN=HP1c PE=1 SV=1
7	AFDB:G5EDE2	0.353	0.371	5.986E-13	175	0.314	0.331	G5EDE2.pdb.gz	CBXH2_CAEEL Chromobox protein homolog hpl-2 OS=Caenorhabditis elegans OX=6239 GN=hpl-2 PE=1 SV=1
8	AFDB:G5EET5	0.334	0.336	2.043E-12	184	0.303	0.304	G5EET5.pdb.gz	CBXH1_CAEEL Chromobox protein homolog hpl-1 OS=Caenorhabditis elegans OX=6239 GN=hpl-1 PE=1 SV=1
9	AFDB:Q9VHG0	0.320	0.339	1.252E-11	174	0.308	0.328	Q9VHG0.pdb.gz	Q9VHG0_DROME Heterochromatin protein 1e OS=Drosophila melanogaster OX=7227 GN=HP1e PE=2 SV=2
10	AFDB:Q54RN0	0.386	0.339	6.067E-11	225	0.297	0.244	Q54RN0.pdb.gz	Q54RN0_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=hcpA PE=4 SV=1
11	PDB:6g0lW	0.277	0.086	4.514E-4	878	0.189	0.040	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
12	PDB:6g0lM	0.309	0.094	6.410E-4	855	0.178	0.039	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
13	PDB:2iw3B	0.273	0.054	4.575E-2	980	0.076	0.014	2iw3B.pdb.gz	Structure of Eef3 and the Mechanism of Transfer RNA Release from the E-Site.
14	PDB:4iluA	0.167	0.182	7.571E-1	165	0.070	0.079	4iluA.pdb.gz
15	PDB:1ak5A	0.142	0.086	1.209	329	0.043	0.024	1ak5A.pdb.gz
16	PDB:1rjtA	0.192	0.397	1.358	73	0.059	0.151	1rjtA.pdb.gz
17	PDB:1mjfA	0.161	0.113	1.527	271	0.022	0.015	1mjfA.pdb.gz
18	PDB:1j8iA	0.157	0.249	1.820	93	0.027	0.054	1j8iA.pdb.gz
19	PDB:1yykA	0.137	0.120	1.820	221	0.070	0.059	1yykA.pdb.gz	Intermediate states of ribonuclease III in complex with double-stranded RNA
20	PDB:7zpkC	0.161	0.142	1.820	233	0.103	0.082	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P83916	3.52e-132	369	185	1.000	1.000	CBX1_HUMAN Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1
2	P83917	3.52e-132	369	185	1.000	1.000	CBX1_MOUSE Chromobox protein homolog 1 OS=Mus musculus OX=10090 GN=Cbx1 PE=1 SV=1
3	O93480	5.83e-100	288	185	0.957	0.957	O93480_CHICK Chromobox protein (CHCB1) OS=Gallus gallus OX=9031 PE=2 SV=1
4	P23198	1.51e-77	231	183	0.703	0.710	CBX3_MOUSE Chromobox protein homolog 3 OS=Mus musculus OX=10090 GN=Cbx3 PE=1 SV=2
5	Q13185	1.71e-77	231	183	0.703	0.710	CBX3_HUMAN Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4
6	Q5RJK5	1.71e-77	231	183	0.703	0.710	Q5RJK5_RAT Chromobox 3 OS=Rattus norvegicus OX=10116 GN=Cbx3 PE=1 SV=1
7	Q61686	2.19e-74	223	191	0.649	0.628	CBX5_MOUSE Chromobox protein homolog 5 OS=Mus musculus OX=10090 GN=Cbx5 PE=1 SV=1
8	P45973	3.70e-74	223	191	0.649	0.628	CBX5_HUMAN Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1
9	V9HWG0	3.70e-74	223	191	0.649	0.628	V9HWG0_HUMAN Epididymis luminal protein 25 OS=Homo sapiens OX=9606 GN=HEL25 PE=1 SV=1
10	Q9W396	1.81e-54	174	240	0.497	0.383	Q9W396_DROME FI06908p OS=Drosophila melanogaster OX=7227 GN=HP1b PE=1 SV=1
11	Q95SE0	1.83e-54	174	240	0.497	0.383	Q95SE0_DROME GM01918p OS=Drosophila melanogaster OX=7227 GN=HP1b PE=1 SV=1
12	P05205	1.09e-43	146	206	0.422	0.379	HP1_DROME Heterochromatin protein 1 OS=Drosophila melanogaster OX=7227 GN=Su(var)205 PE=1 SV=2
13	Q9VCU6	4.81e-34	122	237	0.335	0.262	Q9VCU6_DROME Heterochromatin protein 1c OS=Drosophila melanogaster OX=7227 GN=HP1c PE=1 SV=1
14	Q9VHG0	2.33e-27	103	174	0.319	0.339	Q9VHG0_DROME Heterochromatin protein 1e OS=Drosophila melanogaster OX=7227 GN=HP1e PE=2 SV=2
15	G5EET5	7.93e-25	97.1	184	0.308	0.310	CBXH1_CAEEL Chromobox protein homolog hpl-1 OS=Caenorhabditis elegans OX=6239 GN=hpl-1 PE=1 SV=1
16	G5EDE2	9.04e-25	96.7	175	0.335	0.354	CBXH2_CAEEL Chromobox protein homolog hpl-2 OS=Caenorhabditis elegans OX=6239 GN=hpl-2 PE=1 SV=1
17	Q9VR09	2.18e-22	88.6	106	0.222	0.387	Q9VR09_DROME Heterochromatin protein 6 OS=Drosophila melanogaster OX=7227 GN=HP6 PE=1 SV=1
18	Q5RJL1	1.16e-13	65.1	71	0.195	0.507	Q5RJL1_RAT Cbx3 protein OS=Rattus norvegicus OX=10116 GN=Cbx3 PE=2 SV=1
19	Q49BL2	4.87e-12	65.5	418	0.157	0.069	Q49BL2_DROME Rhino OS=Drosophila melanogaster OX=7227 GN=rhi PE=4 SV=1
20	Q49BL4	4.87e-12	65.5	418	0.157	0.069	Q49BL4_DROME Rhino OS=Drosophila melanogaster OX=7227 GN=rhi PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00385 Chromo	4e-18	76.4	Chromo (CHRromatin Organisation MOdifier) domain
2	PF01393 Chromo_shadow	1.4e-27	106.9	Chromo shadow domain
3	PF01448 ELM2	3.9e+02	13.2	ELM2 domain
4	PF14061 Mtf2_C	2.6	19.7	Polycomb-like MTF2 factor 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 30611.ENSOGAP00000005054

Rank	PPI partner	STRING score	Description
1	30611.ENSOGAP00000018045	0.991	Tripartite motif containing 28
2	30611.ENSOGAP00000010239	0.968	EMSY, BRCA2 interacting transcriptional repressor
3	30611.ENSOGAP00000017526	0.955	Histone-lysine N-methyltransferase
4	30611.ENSOGAP00000015026	0.951	Shugoshin-like 1 (S. pombe)
5	30611.ENSOGAP00000007276	0.936	Pogo transposable element with ZNF domain isoform 2 (Predicted)
6	30611.ENSOGAP00000001965	0.884	Chromatin assembly factor 1, subunit A (p150)
7	30611.ENSOGAP00000018094	0.883	Histone-lysine N-methyltransferase
8	30611.ENSOGAP00000008965	0.873	Chromodomain helicase DNA binding protein 4
9	30611.ENSOGAP00000012706	0.867	Euchromatic histone-lysine N-methyltransferase 2
10	30611.ENSOGAP00000016328	0.867	Uncharacterized protein
11	30611.ENSOGAP00000009233	0.861	Histone-lysine N-methyltransferase
12	30611.ENSOGAP00000000118	0.839	Euchromatic histone-lysine N-methyltransferase 1
13	30611.ENSOGAP00000005582	0.828	Belongs to the histone H3 family.
14	30611.ENSOGAP00000015582	0.828	Histone H3
15	30611.ENSOGAP00000020175	0.828	Histone H3
16	30611.ENSOGAP00000004162	0.809	Rac GTPase activating protein 1
17	30611.ENSOGAP00000001931	0.804	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
18	30611.ENSOGAP00000016528	0.804	Uncharacterized protein
19	30611.ENSOGAP00000007112	0.779	Belongs to the histone H3 family.
20	30611.ENSOGAP00000016069	0.779	Belongs to the histone H3 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.948	chromatin binding
GO:0097159	0.822	organic cyclic compound binding
GO:1901363	0.813	heterocyclic compound binding
GO:0003676	0.791	nucleic acid binding
GO:0003677	0.766	DNA binding
GO:0019899	0.710	enzyme binding
GO:0008134	0.636	transcription factor binding
GO:0042802	0.465	identical protein binding
GO:0008092	0.455	cytoskeletal protein binding
GO:0003779	0.443	actin binding
GO:0140297	0.375	DNA-binding transcription factor binding
GO:0042393	0.355	histone binding
GO:0035064	0.308	methylated histone binding
GO:0060090	0.302	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010605	0.991	negative regulation of macromolecule metabolic process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0045934	0.989	negative regulation of nucleobase-containing compound metabolic process
GO:0009987	0.988	cellular process
GO:1903507	0.975	negative regulation of nucleic acid-templated transcription
GO:0045892	0.974	negative regulation of DNA-templated transcription
GO:0050896	0.950	response to stimulus
GO:0051716	0.849	cellular response to stimulus
GO:0006974	0.830	cellular response to DNA damage stimulus
GO:0071840	0.497	cellular component organization or biogenesis
GO:0016043	0.494	cellular component organization
GO:0006325	0.377	chromatin organization
GO:0071704	0.317	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	1.000	chromatin
GO:0005654	0.997	nucleoplasm
GO:0098687	0.985	chromosomal region
GO:0000792	0.973	heterochromatin
GO:0000775	0.908	chromosome, centromeric region
GO:0032991	0.470	protein-containing complex
GO:0090734	0.388	site of DNA damage
GO:0005721	0.354	pericentric heterochromatin
GO:0010369	0.326	chromocenter
GO:0000781	0.303	chromosome, telomeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]