StarFunc result for job id P84022

User Input

>input (425 residues)
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P84023	0.895	0.893	9.169E-88	426	0.991	0.988	P84023.pdb.gz	SMAD3_CHICK Mothers against decapentaplegic homolog 3 OS=Gallus gallus OX=9031 GN=SMAD3 PE=2 SV=1
2	AFDB:Q9I9P9	0.905	0.824	2.526E-81	468	0.915	0.831	Q9I9P9.pdb.gz	SMAD2_DANRE Mothers against decapentaplegic homolog 2 OS=Danio rerio OX=7955 GN=smad2 PE=2 SV=1
3	AFDB:P97454	0.810	0.743	1.503E-63	465	0.666	0.609	P97454.pdb.gz	SMAD5_MOUSE Mothers against decapentaplegic homolog 5 OS=Mus musculus OX=10090 GN=Smad5 PE=1 SV=2
4	AFDB:B2GS20	0.828	0.757	7.457E-63	466	0.649	0.592	B2GS20.pdb.gz
5	AFDB:P42003	0.816	0.764	1.129E-62	455	0.640	0.598	P42003.pdb.gz	MAD_DROME Protein mothers against dpp OS=Drosophila melanogaster OX=7227 GN=Mad PE=1 SV=1
6	AFDB:Q9I8V2	0.783	0.708	1.612E-62	472	0.661	0.595	Q9I8V2.pdb.gz	SMAD1_DANRE Mothers against decapentaplegic homolog 1 OS=Danio rerio OX=7955 GN=smad1 PE=2 SV=1
7	AFDB:F1P4N1	0.791	0.710	8.487E-62	476	0.664	0.592	F1P4N1.pdb.gz
8	AFDB:O96660	0.577	0.517	1.729E-61	486	0.689	0.603	O96660.pdb.gz	O96660_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Smox PE=1 SV=1
9	AFDB:P97588	0.815	0.742	2.619E-61	468	0.654	0.594	P97588.pdb.gz	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
10	AFDB:O54835	0.752	0.738	1.087E-60	434	0.635	0.622	O54835.pdb.gz	SMAD9_RAT Mothers against decapentaplegic homolog 9 OS=Rattus norvegicus OX=10116 GN=Smad9 PE=1 SV=1
11	PDB:2kb3A	0.164	0.423	9.358E-2	143	0.042	0.126	2kb3A.pdb.gz
12	PDB:7dvqX	0.198	0.480	1.693E-1	156	0.028	0.077	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:6z4eA	0.102	0.190	2.278E-1	207	0.028	0.058	6z4eA.pdb.gz
14	PDB:2ff4A	0.149	0.165	2.888E-1	379	0.026	0.029	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
15	PDB:7ea3J	0.073	0.043	2.888E-1	883	0.033	0.016	7ea3J.pdb.gz
16	PDB:3vehB	0.084	0.081	3.662E-1	451	0.078	0.073	3vehB.pdb.gz	Implications of binding mode and active site flexibility for inhibitor potency against the salicylate synthase from Mycobacterium tuberculosis.
17	PDB:5xqiC	0.119	0.170	6.626E-1	254	0.040	0.067	5xqiC.pdb.gz
18	PDB:5dfkA	0.090	0.169	7.461E-1	185	0.019	0.043	5dfkA.pdb.gz
19	PDB:5b5rA	0.065	0.067	7.917E-1	409	0.040	0.042	5b5rA.pdb.gz
20	PDB:2pfrA	0.076	0.095	9.459E-1	290	0.028	0.041	2pfrA.pdb.gz	The Crystal Structure of Human N-acetyltransferase 2 in complex with CoA

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	F1QXZ9	537	466	0.666	0.607	F1QXZ9_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=sma8 PE=3 SV=1
2	O15198	529	467	0.661	0.602	SMAD9_HUMAN Mothers against decapentaplegic homolog 9 OS=Homo sapiens OX=9606 GN=SMAD9 PE=1 SV=1
3	O54835	513	434	0.649	0.636	SMAD9_RAT Mothers against decapentaplegic homolog 9 OS=Rattus norvegicus OX=10116 GN=Smad9 PE=1 SV=1
4	O70436	777	467	0.918	0.835	SMAD2_RAT Mothers against decapentaplegic homolog 2 OS=Rattus norvegicus OX=10116 GN=Smad2 PE=1 SV=1
5	P42003	539	455	0.656	0.613	MAD_DROME Protein mothers against dpp OS=Drosophila melanogaster OX=7227 GN=Mad PE=1 SV=1
6	P70340	533	465	0.668	0.611	SMAD1_MOUSE Mothers against decapentaplegic homolog 1 OS=Mus musculus OX=10090 GN=Smad1 PE=1 SV=2
7	P84022	890	425	1.000	1.000	SMAD3_HUMAN Mothers against decapentaplegic homolog 3 OS=Homo sapiens OX=9606 GN=SMAD3 PE=1 SV=1
8	P84023	880	426	0.991	0.988	SMAD3_CHICK Mothers against decapentaplegic homolog 3 OS=Gallus gallus OX=9031 GN=SMAD3 PE=2 SV=1
9	P84025	890	425	1.000	1.000	SMAD3_RAT Mothers against decapentaplegic homolog 3 OS=Rattus norvegicus OX=10116 GN=Smad3 PE=1 SV=1
10	P97454	546	465	0.668	0.611	SMAD5_MOUSE Mothers against decapentaplegic homolog 5 OS=Mus musculus OX=10090 GN=Smad5 PE=1 SV=2
11	P97588	534	468	0.666	0.605	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
12	Q15796	778	467	0.920	0.837	SMAD2_HUMAN Mothers against decapentaplegic homolog 2 OS=Homo sapiens OX=9606 GN=SMAD2 PE=1 SV=1
13	Q15797	536	465	0.673	0.615	SMAD1_HUMAN Mothers against decapentaplegic homolog 1 OS=Homo sapiens OX=9606 GN=SMAD1 PE=1 SV=1
14	Q56I98	522	476	0.666	0.595	Q56I98_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD8 PE=2 SV=1
15	Q56I99	545	465	0.668	0.611	SMAD5_CHICK Mothers against decapentaplegic homolog 5 OS=Gallus gallus OX=9031 GN=SMAD5 PE=1 SV=1
16	Q56IA0	536	465	0.661	0.604	Q56IA0_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD1 PE=1 SV=1
17	Q62432	779	467	0.920	0.837	SMAD2_MOUSE Mothers against decapentaplegic homolog 2 OS=Mus musculus OX=10090 GN=Smad2 PE=1 SV=2
18	Q68DB7	544	465	0.668	0.611	Q68DB7_HUMAN Mothers against decapentaplegic homolog OS=Homo sapiens OX=9606 GN=DKFZp781O1323 PE=2 SV=1
19	Q6IRR4	778	467	0.922	0.839	Q6IRR4_XENLA Mothers against decapentaplegic homolog OS=Xenopus laevis OX=8355 GN=smad2.S PE=2 SV=1
20	Q8AY15	861	425	0.969	0.969	Q8AY15_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=madh3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10401 IRF-3	66	14.7	Interferon-regulatory factor 3
2	PF03165 MH1	2.7e-40	148.1	MH1 domain
3	PF03166 MH2	1.4e-70	248.5	MH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015776

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000014415	0.999	Mothers against decapentaplegic homolog
2	61853.ENSNLEP00000021873	0.998	Zinc finger, FYVE domain containing 9
3	61853.ENSNLEP00000013966	0.996	Mothers against decapentaplegic homolog
4	61853.ENSNLEP00000018748	0.995	E1A binding protein p300
5	61853.ENSNLEP00000020704	0.995	Receptor protein serine/threonine kinase
6	61853.ENSNLEP00000014024	0.985	Mothers against decapentaplegic homolog
7	61853.ENSNLEP00000010055	0.983	Neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
8	61853.ENSNLEP00000005036	0.979	TGF-beta receptor type-2
9	61853.ENSNLEP00000018129	0.976	SMAD specific E3 ubiquitin protein ligase 2
10	61853.ENSNLEP00000006363	0.973	SKI-like proto-oncogene
11	61853.ENSNLEP00000011912	0.973	CREB binding protein
12	61853.ENSNLEP00000015110	0.972	Forkhead box O3
13	61853.ENSNLEP00000021481	0.972	Sp1 transcription factor
14	61853.ENSNLEP00000005733	0.970	Tripartite motif containing 33
15	61853.ENSNLEP00000008416	0.968	TGFB-induced factor homeobox 1
16	61853.ENSNLEP00000000962	0.966	Receptor protein serine/threonine kinase
17	61853.ENSNLEP00000001356	0.965	Forkhead box O1
18	61853.ENSNLEP00000005266	0.963	E2F transcription factor 4, p107/p130-binding
19	61853.ENSNLEP00000006554	0.963	Serine/threonine-protein kinase receptor
20	61853.ENSNLEP00000009848	0.961	Forkhead box P3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.966	DNA binding
GO:0043565	0.913	sequence-specific DNA binding
GO:0003690	0.909	double-stranded DNA binding
GO:0000976	0.900	transcription cis-regulatory region binding
GO:0000977	0.812	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.758	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.724	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700	0.695	DNA-binding transcription factor activity
GO:0000981	0.654	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.973	regulation of cellular process
GO:0019222	0.958	regulation of metabolic process
GO:0009987	0.956	cellular process
GO:0007178	0.946	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0010557	0.917	positive regulation of macromolecule biosynthetic process
GO:0051254	0.917	positive regulation of RNA metabolic process
GO:0032501	0.879	multicellular organismal process
GO:0031328	0.849	positive regulation of cellular biosynthetic process
GO:0006357	0.829	regulation of transcription by RNA polymerase II
GO:0032502	0.826	developmental process
GO:0045893	0.822	positive regulation of DNA-templated transcription
GO:0048523	0.750	negative regulation of cellular process
GO:0007179	0.712	transforming growth factor beta receptor signaling pathway
GO:0048856	0.707	anatomical structure development
GO:0007275	0.680	multicellular organism development
GO:0048869	0.678	cellular developmental process
GO:0030154	0.619	cell differentiation
GO:0048513	0.556	animal organ development
GO:0045944	0.509	positive regulation of transcription by RNA polymerase II
GO:0009888	0.314	tissue development
GO:0042221	0.308	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.998	cytoplasm
GO:0005829	0.811	cytosol
GO:0043233	0.456	organelle lumen
GO:0070013	0.451	intracellular organelle lumen
GO:0031981	0.397	nuclear lumen
GO:0005654	0.353	nucleoplasm
GO:0032991	0.334	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]