StarFunc result for job id P84090

User Input

>input (104 residues)
MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDF
IDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P84089	0.991	0.991	4.113E-22	104	1.000	1.000	P84089.pdb.gz	ERH_MOUSE Enhancer of rudimentary homolog OS=Mus musculus OX=10090 GN=Erh PE=1 SV=1
2	PDB:7x39A	0.948	0.772	1.845E-19	128	0.971	0.789	7x39A.pdb.gz
3	AFDB:Q24337	0.985	0.985	2.081E-19	104	0.760	0.760	Q24337.pdb.gz	ER_DROME Protein enhancer of rudimentary OS=Drosophila melanogaster OX=7227 GN=e(r) PE=1 SV=1
4	AFDB:Q22640	0.951	0.960	2.004E-15	103	0.529	0.534	Q22640.pdb.gz	ERH_CAEEL Enhancer of rudimentary homolog OS=Caenorhabditis elegans OX=6239 GN=erh-1 PE=1 SV=1
5	AFDB:Q20057	0.895	0.826	2.961E-12	113	0.365	0.336	Q20057.pdb.gz	ERH2_CAEEL Enhancer of rudimentary homolog 2 OS=Caenorhabditis elegans OX=6239 GN=erh-2 PE=1 SV=2
6	PDB:7ejsB	0.818	0.775	5.862E-12	110	0.346	0.327	7ejsB.pdb.gz
7	PDB:7ejoA	0.786	0.714	2.237E-11	115	0.337	0.304	7ejoA.pdb.gz
8	AFDB:G2TRN4	0.772	0.772	1.003E-9	104	0.260	0.260	G2TRN4.pdb.gz	ERH_SCHPO Enhancer of rudimentary homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erh1 PE=1 SV=1
9	PDB:6akjB	0.761	0.722	9.900E-9	110	0.260	0.245	6akjB.pdb.gz
10	PDB:6s2wB	0.701	0.771	7.002E-6	94	0.231	0.255	6s2wB.pdb.gz
11	AFDB:Q9FER4	0.262	0.124	2.538E-1	246	0.154	0.065	Q9FER4.pdb.gz	Q9FER4_MAIZE Proteasome subunit alpha type OS=Zea mays OX=4577 GN=paa PE=2 SV=1
12	PDB:4lgwA	0.165	0.098	2.751E-1	238	0.154	0.067	4lgwA.pdb.gz
13	PDB:4cr2C	0.241	0.126	3.844E-1	245	0.125	0.053	4cr2C.pdb.gz	Deep Classification of a Large Cryo-Em Dataset Defines the Conformational Landscape of the 26S Proteasome.
14	AFDB:Q9XG77	0.275	0.130	4.055E-1	246	0.144	0.061	Q9XG77.pdb.gz	PSA6_TOBAC Proteasome subunit alpha type-6 OS=Nicotiana tabacum OX=4097 GN=PAA1 PE=2 SV=1
15	AFDB:Q59PZ1	0.306	0.135	4.636E-1	255	0.125	0.051	Q59PZ1.pdb.gz	Q59PZ1_CANAL Proteasome core particle subunit alpha 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PUP2 PE=3 SV=1
16	PDB:1g5hD	0.202	0.068	5.025E-1	415	0.087	0.022	1g5hD.pdb.gz
17	AFDB:Q09682	0.266	0.140	5.301E-1	248	0.115	0.048	Q09682.pdb.gz	PSA3_SCHPO Probable proteasome subunit alpha type-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC13C5.01c PE=3 SV=1
18	AFDB:Q9VIL0	0.197	0.029	6.060E-1	1320	0.096	0.008	Q9VIL0.pdb.gz	BRUN_DROME Protein brunelleschi OS=Drosophila melanogaster OX=7227 GN=brun PE=1 SV=2
19	PDB:1xl6A	0.262	0.111	6.143E-1	291	0.115	0.041	1xl6A.pdb.gz
20	PDB:7pupA	0.271	0.069	6.143E-1	479	0.106	0.023	7pupA.pdb.gz	A haloalkanoic acid halogenase fold in a diversified inositol tris/tetrakisphosphate kinase family reveals the prokaryotic origins of InsP6 synthesis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P84089	5.50e-76	221	104	1.000	1.000	ERH_MOUSE Enhancer of rudimentary homolog OS=Mus musculus OX=10090 GN=Erh PE=1 SV=1
2	P84090	5.50e-76	221	104	1.000	1.000	ERH_HUMAN Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1
3	Q94554	5.17e-58	175	104	0.779	0.779	ER_DROVI Protein enhancer of rudimentary OS=Drosophila virilis OX=7244 GN=e(r) PE=3 SV=1
4	Q24337	1.10e-57	174	104	0.760	0.760	ER_DROME Protein enhancer of rudimentary OS=Drosophila melanogaster OX=7227 GN=e(r) PE=1 SV=1
5	Q22640	1.50e-35	119	103	0.529	0.534	ERH_CAEEL Enhancer of rudimentary homolog OS=Caenorhabditis elegans OX=6239 GN=erh-1 PE=1 SV=1
6	Q20057	7.78e-25	92.0	113	0.356	0.327	ERH2_CAEEL Enhancer of rudimentary homolog 2 OS=Caenorhabditis elegans OX=6239 GN=erh-2 PE=1 SV=2
7	G2TRN4	2.48e-08	49.7	104	0.250	0.250	ERH_SCHPO Enhancer of rudimentary homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erh1 PE=1 SV=1
8	P24058	2.1	29.3	468	0.173	0.038	ARLY2_ANAPL Argininosuccinate lyase OS=Anas platyrhynchos OX=8839 GN=ASL2 PE=1 SV=4
9	Q8WXD2	3.5	28.9	468	0.183	0.041	SCG3_HUMAN Secretogranin-3 OS=Homo sapiens OX=9606 GN=SCG3 PE=1 SV=3
10	Q9W1M7	3.9	28.9	949	0.212	0.023	Q9W1M7_DROME Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Drosophila melanogaster OX=7227 GN=Pi3K59F PE=1 SV=2
11	P91635	4.1	28.9	949	0.212	0.023	P91635_DROME Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Drosophila melanogaster OX=7227 GN=Pi3K59F PE=2 SV=1
12	Q9VSF2	4.1	28.5	993	0.192	0.020	MED24_DROME Mediator of RNA polymerase II transcription subunit 24 OS=Drosophila melanogaster OX=7227 GN=MED24 PE=1 SV=2
13	Q66GQ5	7.0	28.1	540	0.115	0.022	RWA3_ARATH Protein REDUCED WALL ACETYLATION 3 OS=Arabidopsis thaliana OX=3702 GN=RWA3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01133 ER	2.9e-45	163.7	Enhancer of rudimentary

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9612.ENSCAFP00000039070

Rank	PPI partner	STRING score	Description
1	9612.ENSCAFP00000020415	0.900	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone pre-mRNA 3'-end processing.
2	9612.ENSCAFP00000042139	0.900	Small nuclear ribonucleoprotein D3 polypeptide 18kDa
3	9612.ENSCAFP00000038933	0.848	Canis lupus familiaris small nuclear ribonucleoprotein polypeptide G (SNRPG), mRNA
4	9612.ENSCAFP00000008786	0.839	Aly/REF export factor
5	9612.ENSCAFP00000026957	0.835	Small nuclear ribonucleoprotein D1 polypeptide 16kDa
6	9612.ENSCAFP00000000897	0.833	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome.
7	9612.ENSCAFP00000001941	0.833	Uncharacterized protein
8	9612.ENSCAFP00000006557	0.833	Canis lupus familiaris small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), mRNA
9	9612.ENSCAFP00000009582	0.827	Small nuclear ribonucleoprotein polypeptide F
10	9612.ENSCAFP00000036247	0.827	Uncharacterized protein
11	9612.ENSCAFP00000002023	0.813	Serine/arginine-rich splicing factor 3
12	9612.ENSCAFP00000025827	0.812	Interleukin enhancer binding factor 2
13	9612.ENSCAFP00000031897	0.800	Spliceosome RNA helicase DDX39B
14	9612.ENSCAFP00000004276	0.791	Heterogeneous nuclear ribonucleoprotein A2/B1
15	9612.ENSCAFP00000029146	0.786	Polypyrimidine tract binding protein 1
16	9612.ENSCAFP00000008914	0.785	Uncharacterized protein
17	9612.ENSCAFP00000025837	0.785	Chromatin target of PRMT1
18	9612.ENSCAFP00000019636	0.780	Heterogeneous nuclear ribonucleoprotein R
19	9612.ENSCAFP00000008442	0.778	Heterogeneous nuclear ribonucleoprotein L
20	9612.ENSCAFP00000019680	0.769	Transformer 2 beta homolog (Drosophila)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000166	0.999	nucleotide binding
GO:0003676	0.997	nucleic acid binding
GO:0003677	0.990	DNA binding
GO:0003723	0.974	RNA binding
GO:0008327	0.943	methyl-CpG binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.963	organic substance metabolic process
GO:0044237	0.958	cellular metabolic process
GO:0006807	0.951	nitrogen compound metabolic process
GO:0044238	0.942	primary metabolic process
GO:0046483	0.942	heterocycle metabolic process
GO:0006725	0.942	cellular aromatic compound metabolic process
GO:0034641	0.942	cellular nitrogen compound metabolic process
GO:1901360	0.941	organic cyclic compound metabolic process
GO:0006139	0.921	nucleobase-containing compound metabolic process
GO:0032501	0.579	multicellular organismal process
GO:0032502	0.564	developmental process
GO:1901564	0.554	organonitrogen compound metabolic process
GO:0044281	0.545	small molecule metabolic process
GO:0072527	0.487	pyrimidine-containing compound metabolic process
GO:0055086	0.466	nucleobase-containing small molecule metabolic process
GO:0001503	0.438	ossification
GO:0001649	0.397	osteoblast differentiation
GO:1901657	0.389	glycosyl compound metabolic process
GO:0050789	0.339	regulation of biological process
GO:0050794	0.327	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0032991	0.991	protein-containing complex
GO:0005634	0.981	nucleus
GO:0005737	0.941	cytoplasm
GO:0016020	0.717	membrane
GO:0031981	0.436	nuclear lumen
GO:0030496	0.423	midbody
GO:1902494	0.406	catalytic complex
GO:0034708	0.374	methyltransferase complex
GO:0005654	0.339	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]